DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and Prosbeta4

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster

Alignment Length:213 Identity:40/214 (19%)
Similarity:82/214 (38%) Gaps:62/214 (29%)


  Fly    33 TAVGVRGANCVVLGVEKS---SVSEMQEDRTVRKISMLDRHVALAFAGLTADARILINRGQVECQ 94
            |.:|::|.:.|:|..:.:   |:..|:||:  .||..:...:.::..|.:.|.            
  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQ--NKIHKVSDSLLISTVGESGDT------------ 53

  Fly    95 SHRLNFENQVTLEYITRYLAQLKQK------------YTQCN------GRRPFGISCLIGGIDAD 141
                   .|.| |:|::.:|..|.:            :|:.|      .|.|:.:...:.|.|.:
  Fly    54 -------EQFT-EFISKNIALYKMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPN 110

  Fly   142 GSARLFHTEPSGIFHEYKATAT-------GRWANTVREFFEKAYSDHEVTTKCDAIKLAMRALLE 199
            ..       |...|.:|.|.|.       |..|......:::.:  |...|:.:|..:..:.:.|
  Fly   111 AG-------PELTFIDYLANALPVNYAGHGYGAIFASSIYDRYW--HPNITQAEAYDVFKKCIAE 166

  Fly   200 VTQMSQMRLE---VAVLE 214
            :.:...:.|:   |||::
  Fly   167 IQKRLVVNLKNFTVAVVD 184

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 40/214 (19%)
proteasome_alpha_type_7 5..213 CDD:239724 40/211 (19%)
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 40/214 (19%)
proteasome_beta_type_2 1..192 CDD:239727 40/214 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C79724377
eggNOG 1 0.900 E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11599
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.