| Sequence 1: | NP_650910.1 | Gene: | Prosalpha4T1 / 42457 | FlyBaseID: | FBgn0265606 | Length: | 249 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_999862.1 | Gene: | psma4 / 326687 | ZFINID: | ZDB-GENE-040426-1932 | Length: | 261 | Species: | Danio rerio | 
| Alignment Length: | 256 | Identity: | 87/256 - (33%) | 
|---|---|---|---|
| Similarity: | 147/256 - (57%) | Gaps: | 11/256 - (4%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly     1 MSSRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTV-RKI 64 
  Fly    65 SMLDRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPF 129 
  Fly   130 GISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAM 194 
  Fly   195 RAL---LEVTQMSQMRLEVAVL--ENGK-PMKMLDSVVISEIVKIVQNEKELQAKAHKMKR 249  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Prosalpha4T1 | NP_650910.1 | PRK03996 | 5..239 | CDD:235192 | 78/240 (33%) | 
| proteasome_alpha_type_7 | 5..213 | CDD:239724 | 68/211 (32%) | ||
| psma4 | NP_999862.1 | PTZ00246 | 1..237 | CDD:173491 | 79/236 (33%) | 
| proteasome_alpha_type_4 | 3..216 | CDD:239721 | 69/213 (32%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1222564at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.820 | |||||