DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and Psma1

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_058974.1 Gene:Psma1 / 29668 RGDID:61841 Length:263 Species:Rattus norvegicus

Alignment Length:203 Identity:67/204 (33%)
Similarity:108/204 (53%) Gaps:3/204 (1%)


  Fly     3 SRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKISML 67
            ::|...:|::||.|.:.|:|||.|||::||..||::.....||...|.:.||:...:  :||..:
  Rat     4 NQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ--KKILHV 66

  Fly    68 DRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGIS 132
            |.|:.::.||||||||:|.|..:.||...|..|:..:.:..:...:....|..||..||||:|:.
  Rat    67 DNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVG 131

  Fly   133 CLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAMRAL 197
            .||.|.| |....:|.|.||..:.:.:|.:.|..:.:.|.:.|:..|:.......:.:|..:|||
  Rat   132 LLIAGYD-DMGPHVFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMQCNLDELVKHGLRAL 195

  Fly   198 LEVTQMSQ 205
            .|.....|
  Rat   196 RETLPAEQ 203

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 67/202 (33%)
proteasome_alpha_type_7 5..213 CDD:239724 67/202 (33%)
Psma1NP_058974.1 proteasome_alpha_type_1 6..216 CDD:239718 67/202 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.