DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and pre6

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_595165.1 Gene:pre6 / 2540175 PomBaseID:SPBC106.16 Length:259 Species:Schizosaccharomyces pombe

Alignment Length:248 Identity:123/249 (49%)
Similarity:177/249 (71%) Gaps:3/249 (1%)


  Fly     3 SRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKISML 67
            |.|.|||::|||||.||||||.|||||:|:||:.:||..|:|:|||:.:|.::|.....:||:|:
pombe     2 SGYDRALSVFSPDGRLLQVEYGQEAVRRGTTAIALRGNECIVIGVERKNVPKLQNVSNFQKIAMV 66

  Fly    68 DRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGIS 132
            |.||.||||||.|||||||::.:||.|:|:||..:.|::||:|||:|.::|||||..|.||||:|
pombe    67 DNHVCLAFAGLNADARILIDKARVEAQNHKLNLADPVSIEYLTRYVAGVQQKYTQSGGVRPFGVS 131

  Fly   133 CLIGGID-ADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAMRA 196
            .||.|.| .|.:.|::.|||:||::.:||||.||.:...||:.||.:.  |..::.:.|.||:.:
pombe   132 TLIAGFDVGDNTPRVYQTEPAGIYNAWKATAIGRASKAAREYLEKNWK--EGLSRDETIHLAVSS 194

  Fly   197 LLEVTQMSQMRLEVAVLENGKPMKMLDSVVISEIVKIVQNEKELQAKAHKMKR 249
            ||||.|.:...:|:|:::.||.::.|.|..|..|||.:|:|||.:|...|..|
pombe   195 LLEVVQTASGNIELAIMDPGKDVEFLHSDKIDTIVKEIQDEKEAEAARKKSGR 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 118/235 (50%)
proteasome_alpha_type_7 5..213 CDD:239724 107/209 (51%)
pre6NP_595165.1 PRK03996 1..232 CDD:235192 116/232 (50%)
proteasome_alpha_type_7 4..211 CDD:239724 107/209 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H2086
Inparanoid 1 1.050 265 1.000 Inparanoid score I718
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001835
OrthoInspector 1 1.000 T631465
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11599
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
99.030

Return to query results.
Submit another query.