DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and Psmb7

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_035317.1 Gene:Psmb7 / 19177 MGIID:107637 Length:277 Species:Mus musculus


Alignment Length:210 Identity:46/210 - (21%)
Similarity:83/210 - (39%) Gaps:30/210 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ALTIFSPD-----------GHLLQVEYAQ------EAVRKGSTAVGVRGANCVVLGVEKSSVSEM 55
            |:::|.|.           ..:|:.::|:      :|.:.|:|..||...:.:|||.:..:...|
Mouse     3 AVSVFQPPVGGFSFDNCRRNAVLEADFAKKGFKLPKARKTGTTIAGVVYKDGIVLGADTRATEGM 67

  Fly    56 -QEDRTVRKISMLDRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQK 119
             ..|:...||..:..::....||..||..:.........:.|.|.......:....|.|.|:..:
Mouse    68 VVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVVTANRMLKQMLFR 132

  Fly   120 YTQCNGRRPFGISCLIGGIDADGSARLFHTEPSGIFHE--YKATATGRWANTVREFFEKAYSDHE 182
            |     :...|.:.::||:|..| ..|:...|.|...:  |....:|..| .:..|.:|...|.|
Mouse   133 Y-----QGYIGAALVLGGVDVTG-PHLYSIYPHGSTDKLPYVTMGSGSLA-AMAVFEDKFRPDME 190

  Fly   183 VTTKCDAIKLAMRAL 197
               :.:|.||...|:
Mouse   191 ---EEEAKKLVSEAI 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 46/210 (22%)
proteasome_alpha_type_7 5..213 CDD:239724 46/210 (22%)
Psmb7NP_035317.1 PRE1 41..225 CDD:223711 40/172 (23%)
proteasome_beta_type_7 44..232 CDD:239732 39/169 (23%)
Pr_beta_C 236..271 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.