DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and Psmb5

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_035316.1 Gene:Psmb5 / 19173 MGIID:1194513 Length:264 Species:Mus musculus

Alignment Length:181 Identity:38/182 (21%)
Similarity:84/182 (46%) Gaps:26/182 (14%)


  Fly    31 GSTAVGVRGANCVVLGVE-KSSVSEMQEDRTVRKISMLDRHVALAFAGLTADA----RILINRGQ 90
            |:|.:..:..:.|::..: :::.......:||:|:..::.::....||..||.    |:|..   
Mouse    59 GTTTLAFKFLHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR--- 120

  Fly    91 VECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGIS--CLIGGIDADGSARLFHTEPSG 153
             :|:.:.|..:.::::...::.||.:..:|      :..|:|  .:|.|.|..|.. |::.:..|
Mouse   121 -QCRIYELRNKERISVAAASKLLANMVYQY------KGMGLSMGTMICGWDKRGPG-LYYVDSEG 177

  Fly   154 IFHEYKATATGRWANTVREF--FEKAYS-DHEVTTKCDAIKLAMRALLEVT 201
              :....||....:.:|..:  .::.|| |.:|.   :|..||.||:.:.|
Mouse   178 --NRISGTAFSVGSGSVYAYGVMDRGYSYDLKVE---EAYDLARRAIYQAT 223

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 38/182 (21%)
proteasome_alpha_type_7 5..213 CDD:239724 38/182 (21%)
Psmb5NP_035316.1 proteasome_beta_type_5 60..247 CDD:239730 37/181 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.