DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and Psmb10

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_006530832.1 Gene:Psmb10 / 19171 MGIID:1096380 Length:310 Species:Mus musculus

Alignment Length:149 Identity:35/150 (23%)
Similarity:67/150 (45%) Gaps:7/150 (5%)


  Fly    17 HLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSE-MQEDRTVRKISMLDRHVALAFAGLTA 80
            |:|.......|.:.|:|..|:...:.|:||.:..:.:: :..|::..||..:...:....||:.|
Mouse    25 HVLPGLRVPHARKTGTTIAGLVFRDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAA 89

  Fly    81 DARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGISCLIGGIDADGSAR 145
            |..:.......:.:.|.|:...:..:..:||.|.|...:|     :...|.|.::||:|.:| .:
Mouse    90 DTEMTTRMAASKMELHALSTGREPRVATVTRILRQTLFRY-----QGHVGASLVVGGVDLNG-PQ 148

  Fly   146 LFHTEPSGIFHEYKATATG 164
            |:...|.|.:.....||.|
Mouse   149 LYEVHPHGSYSRLPFTALG 167

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 35/150 (23%)
proteasome_alpha_type_7 5..213 CDD:239724 35/150 (23%)
Psmb10XP_006530832.1 PRE1 37..258 CDD:223711 32/138 (23%)
proteasome_beta_type_7 40..263 CDD:239732 31/135 (23%)
Pr_beta_C 269..304 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.