DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and Psmb1

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_035315.1 Gene:Psmb1 / 19170 MGIID:104884 Length:240 Species:Mus musculus

Alignment Length:217 Identity:37/218 (17%)
Similarity:80/218 (37%) Gaps:40/218 (18%)


  Fly    19 LQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVR-----KISMLDRHVALAFAGL 78
            :|:.::..|. .|.|.:.:.|.:..::    :|.:.:.|..::.     |...|.....:..:|.
Mouse    25 VQLRFSPYAF-NGGTVLAIAGEDFSIV----ASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGF 84

  Fly    79 TADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRR--PFGISCLIGGIDAD 141
            ..|...|....:...:.::.:....:|...|...|:      |....||  |:.:..:|||:|.:
Mouse    85 HGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLS------TILYSRRFFPYYVYNIIGGLDEE 143

  Fly   142 GSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAMRALLEVTQMSQM 206
            |...::..:|.|.:......|.|..:..::...     |::|..|                 :..
Mouse   144 GKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLL-----DNQVGFK-----------------NMQ 186

  Fly   207 RLEVAVLENGKPMKMLDSVVIS 228
            .:|...|...:.|:::..|.||
Mouse   187 NVEHVPLTLDRAMRLVKDVFIS 208

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 37/218 (17%)
proteasome_alpha_type_7 5..213 CDD:239724 32/201 (16%)
Psmb1NP_035315.1 PRE1 18..240 CDD:223711 37/218 (17%)
proteasome_beta_type_1 29..240 CDD:239726 36/214 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.