DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and Psma3

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_035314.3 Gene:Psma3 / 19167 MGIID:104883 Length:255 Species:Mus musculus

Alignment Length:244 Identity:75/245 (31%)
Similarity:124/245 (51%) Gaps:38/245 (16%)


  Fly     5 YGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKISMLDR 69
            |..:.:.|||||.:.|||||.:||...|||:|:|..:.||.||||..:|::.|:.:.:::..:||
Mouse     8 YDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDR 72

  Fly    70 HVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGISCL 134
            ||.:|.|||.||||.|.:..:.|..:.|.||...:.|:::...:|.....||..:..||||.|.:
Mouse    73 HVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFM 137

  Fly   135 IGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAMRALLE 199
            :|...|:..|:|:..:|||:.:.|...|.|:                        .:.|.:..:|
Mouse   138 LGSYSANDGAQLYMIDPSGVSYGYWGCAIGK------------------------ARQAAKTEIE 178

  Fly   200 VTQMSQMRLEVAVLENGKPMKMLDSVVISEIVKIVQNEKELQAKAHKMK 248
            ..||.:|.....|.|            :::|:.||.:  |::.||.:::
Mouse   179 KLQMKEMTCRDVVKE------------VAKIIYIVHD--EVKDKAFELE 213

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 72/234 (31%)
proteasome_alpha_type_7 5..213 CDD:239724 68/208 (33%)
Psma3NP_035314.3 proteasome_alpha_type_3 5..217 CDD:239720 75/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.