DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and pbs-3

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_494913.1 Gene:pbs-3 / 173858 WormBaseID:WBGene00003949 Length:204 Species:Caenorhabditis elegans

Alignment Length:173 Identity:37/174 (21%)
Similarity:67/174 (39%) Gaps:44/174 (25%)


  Fly    31 GSTAVGVRGANCVV------LGVEKSSVSEMQEDRTVRKISMLDRHVALAFAGLTADAR-----I 84
            |.|.|.:.|..||.      :|.:.::::..|     :|:..:...|.:..||..:|||     |
 Worm     8 GGTVVAMAGDECVCIASDLRIGEQMTTIATDQ-----KKVHKVTDKVYVGLAGFQSDARTVLEKI 67

  Fly    85 LINRGQVECQSHRLNFENQVTLEYITR--YLAQLKQKYTQCNGRRPFGISCLIGGIDADGSARLF 147
            :..:...|.:.:| |.:.||..|.|:.  |..:....:|:     |     |:.|:|......:.
 Worm    68 MFRKNLYELRENR-NIKPQVLSEMISNLAYQHRFGSYFTE-----P-----LVAGLDDTNKPYIC 121

  Fly   148 HTEPSGIF---HEYKATATGR----------WANTVR--EFFE 175
            ..:..|..   .::.|..||:          |...::  |.||
 Worm   122 CMDTIGCVSAPRDFVAVGTGQEYLLGVCENFWRENMKPDELFE 164

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 37/174 (21%)
proteasome_alpha_type_7 5..213 CDD:239724 37/174 (21%)
pbs-3NP_494913.1 PRE1 3..193 CDD:223711 37/174 (21%)
proteasome_beta_type_3 6..200 CDD:239728 37/174 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.