DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and pbs-2

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_493271.1 Gene:pbs-2 / 173168 WormBaseID:WBGene00003948 Length:277 Species:Caenorhabditis elegans

Alignment Length:196 Identity:46/197 (23%)
Similarity:73/197 (37%) Gaps:51/197 (26%)


  Fly    24 AQEAVRKGSTAVGVRGANCVVLGVE-KSSVSEMQEDRTVRKISMLDRHVALAFAGLTAD------ 81
            |.:....|:|.|.|.....:|:|.: :::...:..|:...|:..|...:....||..||      
 Worm    39 APKLTSTGTTIVAVAFKGGLVMGADSRATAGNIIADKHCEKVHKLTESIYACGAGTAADLDQVTK 103

  Fly    82 -----ARIL-INRGQV--------ECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGIS 132
                 .|:| :|.|:.        :.:.|..|::.     ||..||                   
 Worm   104 MLSGNLRLLELNTGRKARVITALRQAKQHLFNYQG-----YIGAYL------------------- 144

  Fly   133 CLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEV-TTKCDAIKLAMRA 196
             ||||:|..| ..|:....:|....:..||.|..:.......|:   |.:| .||.:|.||..||
 Worm   145 -LIGGVDPTG-PHLYMCSANGTTMAFPFTAQGSGSYAAITILER---DFKVDMTKDEAEKLVQRA 204

  Fly   197 L 197
            |
 Worm   205 L 205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 46/197 (23%)
proteasome_alpha_type_7 5..213 CDD:239724 46/197 (23%)
pbs-2NP_493271.1 PRE1 43..228 CDD:223711 45/193 (23%)
proteasome_beta_type_7 47..235 CDD:239732 44/189 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.