DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and pbs-2

DIOPT Version :10

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_493271.1 Gene:pbs-2 / 173168 WormBaseID:WBGene00003948 Length:277 Species:Caenorhabditis elegans


Alignment Length:196 Identity:46/196 - (23%)
Similarity:73/196 - (37%) Gaps:51/196 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 AQEAVRKGSTAVGVRGANCVVLGVE-KSSVSEMQEDRTVRKISMLDRHVALAFAGLTAD------ 81
            |.:....|:|.|.|.....:|:|.: :::...:..|:...|:..|...:....||..||      
 Worm    39 APKLTSTGTTIVAVAFKGGLVMGADSRATAGNIIADKHCEKVHKLTESIYACGAGTAADLDQVTK 103

  Fly    82 -----ARIL-INRGQV--------ECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGIS 132
                 .|:| :|.|:.        :.:.|..|::.     ||..||                   
 Worm   104 MLSGNLRLLELNTGRKARVITALRQAKQHLFNYQG-----YIGAYL------------------- 144

  Fly   133 CLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEV-TTKCDAIKLAMRA 196
             ||||:|..| ..|:....:|....:..||.|..:.......|:   |.:| .||.:|.||..||
 Worm   145 -LIGGVDPTG-PHLYMCSANGTTMAFPFTAQGSGSYAAITILER---DFKVDMTKDEAEKLVQRA 204

  Fly   197 L 197
            |
 Worm   205 L 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 proteasome_alpha_type_7 5..213 CDD:239724 46/196 (23%)
pbs-2NP_493271.1 proteasome_beta_type_7 47..235 CDD:239732 44/188 (23%)

Return to query results.
Submit another query.