DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and AT4G15165

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001190735.1 Gene:AT4G15165 / 10723067 AraportID:AT4G15165 Length:208 Species:Arabidopsis thaliana


Alignment Length:217 Identity:63/217 - (29%)
Similarity:103/217 - (47%) Gaps:48/217 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSE-MQEDRTVRKI 64
            ||.||....|||||:|.|.|||||.||:....:|:|:...:.|||..||...|: :|...::.|:
plant     1 MSRRYDSRTTIFSPEGRLYQVEYAMEAIGNAGSAIGILAKDGVVLVGEKKVTSKLLQTSSSMEKM 65

  Fly    65 SMLDRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPF 129
            ..:|.|||.|.||:.:||.||||..:|:.|                |:                 
plant    66 YKIDDHVACAVAGIMSDANILINTARVQAQ----------------RW----------------- 97

  Fly   130 GISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAM 194
                     |.:...:|:.::|||.:..::|.|.|......:...::.|.|.  .|:.:.::||:
plant    98 ---------DRNHGFQLYMSDPSGNYGGWQAAAVGANNQAAQSILKQDYKDD--ATREEVVQLAI 151

  Fly   195 RAL---LEVTQMSQMRLEVAVL 213
            :.|   ::.|.::..:||:|.|
plant   152 KVLSKTMDSTSLTAEKLELAEL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 60/213 (28%)
proteasome_alpha_type_7 5..213 CDD:239724 59/211 (28%)
AT4G15165NP_001190735.1 Ntn_hydrolase 3..173 CDD:382028 60/213 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.