DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and AT4G15165

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001190735.1 Gene:AT4G15165 / 10723067 AraportID:AT4G15165 Length:208 Species:Arabidopsis thaliana

Alignment Length:217 Identity:63/218 (29%)
Similarity:103/218 (47%) Gaps:48/218 (22%)


  Fly     1 MSSRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSE-MQEDRTVRKI 64
            ||.||....|||||:|.|.|||||.||:....:|:|:...:.|||..||...|: :|...::.|:
plant     1 MSRRYDSRTTIFSPEGRLYQVEYAMEAIGNAGSAIGILAKDGVVLVGEKKVTSKLLQTSSSMEKM 65

  Fly    65 SMLDRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPF 129
            ..:|.|||.|.||:.:||.||||..:|:.|                |:                 
plant    66 YKIDDHVACAVAGIMSDANILINTARVQAQ----------------RW----------------- 97

  Fly   130 GISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAM 194
                     |.:...:|:.::|||.:..::|.|.|......:...::.|.|.  .|:.:.::||:
plant    98 ---------DRNHGFQLYMSDPSGNYGGWQAAAVGANNQAAQSILKQDYKDD--ATREEVVQLAI 151

  Fly   195 RAL---LEVTQMSQMRLEVAVL 213
            :.|   ::.|.::..:||:|.|
plant   152 KVLSKTMDSTSLTAEKLELAEL 173

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 60/214 (28%)
proteasome_alpha_type_7 5..213 CDD:239724 59/212 (28%)
AT4G15165NP_001190735.1 Ntn_hydrolase 3..173 CDD:294319 60/214 (28%)
arc_protsome_A 5..171 CDD:163366 58/210 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1222564at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.