DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and htr1ab

DIOPT Version :8

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001139238.1 Gene:htr1ab / 797538 ZFINID:ZDB-GENE-090409-2 Length:403 Species:Danio rerio

Alignment Length:506 Identity:148/507 (29%)
Similarity:224/507 (44%) Gaps:142/507 (28%)


  Fly   100 LQLAVPEWEALLTALVLSVIIVLTIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVALLVLP 164
            |.:.||....:.|:|::..:|:.:|.||..|:.::...:.|:.|.|:.|.||||.||.|::||||
Zfish    26 LPVKVPLSYQISTSLLIGALILCSIFGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLP 90

  Fly   165 FNVAYSILGRWEFGIHLCKLWLTCDVLCCTSSILNLCAIALDRYWAITDPINYAQKRTVGRVLLL 229
            ....|.:|.:|..|...|.::::.|:||||||||:||||||||||||||||:|.:|||:.|..||
Zfish    91 MAALYQVLDKWTLGQVTCDIFISLDILCCTSSILHLCAIALDRYWAITDPIDYMKKRTLKRAALL 155

  Fly   230 ISGVWLLSLLISSPPLIGWNDWPDEFTSATPCELTSQRGYVIYSSLGSFFIPLAIMTIVYIEIFV 294
            |:..|.:...||.||::.....|      ..|.::....|.|||:..:|:|||.:|.::|..||.
Zfish   156 ITVTWFVGFSISIPPMLIMKSQP------KTCMISHDPWYTIYSTFCAFYIPLILMLVLYGRIFK 214

  Fly   295 ATRRRLRERARANKLNTIALKSTELEPMANSSPVAASNSGSKSRLLASWLCCGRDRAQFATPMIQ 359
            |.|.|:|:..|                                                      
Zfish   215 AARFRIRKTVR------------------------------------------------------ 225

  Fly   360 NDQESISSETHQPQDSSKAGPHGNSDPQQQHVVVLVKKSRRAKTKDSIKHGKTRGGRKSQSSSTC 424
                       :|:                      ||..:..|.......:..|.......|..
Zfish   226 -----------KPE----------------------KKRVKCLTVSPALFKRANGELSKNWKSAV 257

  Fly   425 EPHGEQQLLPAGGDGGSCQPGGGHSGGGKSDAEISTESGSDPKGCIQVCVTQADEQTSLKLTPPQ 489
            ||                                      .|..|:...:..|::..||::....
Zfish   258 EP--------------------------------------KPAACVNGAIKHAEDGESLEIIEVH 284

  Fly   490 SSTGVAAVSVTPLQKKTSGVNQF-------IEEKQKISLSKERRAARTLGIIMGVFVICWLPFFL 547
            |:    :.:..||....:.|..|       .|.|:|::|::||:..:|||||||.|::||||||:
Zfish   285 SN----SKNNLPLPNTPNSVPLFENKHEKNTEAKRKLALARERKTVKTLGIIMGTFILCWLPFFI 345

  Fly   548 MYVILPFCQTCCPTNKFKNFITWLGYINSGLNPVIYTIFNLDYRRAFKRLL 598
            ..:::|||.||......::.|.||||.||.|||:||..||.|::.|||:::
Zfish   346 KALVMPFCPTCVMPLWLQDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKII 396

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 63/131 (48%)
7tm_1 126..>293 CDD:278431 74/167 (44%)
htr1abNP_001139238.1 7tm_4 46..>208 CDD:304433 74/168 (44%)
7tm_1 52..381 CDD:278431 134/464 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133249
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.