DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and adra2a

DIOPT Version :8

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001072843.1 Gene:adra2a / 780304 XenbaseID:XB-GENE-877030 Length:434 Species:Xenopus tropicalis

Alignment Length:559 Identity:171/559 - (30%)
Similarity:251/559 - (44%) Gaps:162/559 - (28%)


  Fly    64 EGLTTVTAALSTAQADKDSA--------GECEGAVEELHASILGLQLAVPEWEALLTALVLSVII 120
            |..|.|...||..:..:|.:        |..||          |...::....||:|  ::.:::
 Frog     5 ENPTEVRGGLSPMECLEDCSNTTLNNGNGTWEG----------GPPYSLEVTLALIT--LVGMLM 57

  Fly   121 VLTIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVALLVLPFNVAYSILGRWEFGIHLCKLW 185
            :.|:.||:|||::|||.:.|:..||.|:||||.||:.||.||:||:::..::|.|.||...|:::
 Frog    58 LFTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLSNEVMGYWYFGKVWCEIY 122

  Fly   186 LTCDVLCCTSSILNLCAIALDRYWAITDPINYAQKRTVGRVLLLISGVWLLSLLISSPPLI---- 246
            |..|||.|||||::||||:|||||:||..|.|..|||..|:..:|..||::|.:||.||||    
 Frog   123 LALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKCIIFIVWVISAVISFPPLITIEK 187

  Fly   247 --GWNDWPDEFTSATPCELTSQRGYVIYSSLGSFFIPLAIMTIVYIEIFVATRRRLR----ERAR 305
              |..:.|       .|::..::.|:||||:||||.|..||.:|||.|:...::|.|    :|:.
 Frog   188 ESGKVEMP-------ICKINDEKWYIIYSSIGSFFAPCVIMVLVYIRIYQIAKKRTRVPPGKRSN 245

  Fly   306 ANKL-----NTIALKSTELEPMANSSPVAASNSGSKSRLLASWLCCGRDRAQFATPMIQNDQESI 365
            |.::     |.:|.|  :|....|......|.......:.|:.:                |.:..
 Frog   246 AAEVGAKQHNGLAEK--DLPVKLNGDKAGGSGGDHGKEVEANGV----------------DMDDS 292

  Fly   366 SSETHQPQDSSKAGPHGNSDPQQQHVVVLVKKSRRAKTKDSIKHGKTRGGRKSQSSSTCEPHGEQ 430
            ||..||..:..:|                      .|.:|.:..||                |:.
 Frog   293 SSSEHQEDNQYQA----------------------RKKQDKLPRGK----------------GKT 319

  Fly   431 QLLPAGGDGGSCQPGGGHSGGGKSDAEISTESGSDPKGCIQVCVTQADEQTSLKLTPPQSSTGVA 495
            :|       ...:||         |:....|...:||                            
 Frog   320 KL-------SQIKPG---------DSLPRREEERNPK---------------------------- 340

  Fly   496 AVSVTPLQKKTSGVNQFIEEKQKISLSKERRAARTLGIIMGVFVICWLPFFLMYVILPFCQTC-C 559
             ||                 :.|...::|:|....|.:::|||||||.|||..|.::..|..| .
 Frog   341 -VS-----------------RWKGRQNREKRFTFVLAVVIGVFVICWFPFFFTYTLMAVCVRCYV 387

  Fly   560 PTNKFKNFITWLGYINSGLNPVIYTIFNLDYRRAFKRLL 598
            |...|| |..|.||.||.|||.||||||.|:|||||::|
 Frog   388 PAPLFK-FFFWFGYCNSSLNPFIYTIFNHDFRRAFKKIL 425

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 62/130 (48%)
7tm_1 126..>293 CDD:278431 83/172 (48%)
adra2aNP_001072843.1 7tmA_alpha2A_AR 47..421 CDD:320445 157/501 (31%)
TM helix 1 48..74 CDD:320445 11/27 (41%)
TM helix 2 81..107 CDD:320445 15/25 (60%)
TM helix 3 119..149 CDD:320445 19/29 (66%)
TM helix 4 161..184 CDD:320445 10/22 (45%)
TM helix 5 202..231 CDD:320445 16/28 (57%)
TM helix 6 349..379 CDD:320445 14/29 (48%)
TM helix 7 389..414 CDD:320445 15/25 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.