DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and htr1d

DIOPT Version :8

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001139158.1 Gene:htr1d / 556429 ZFINID:ZDB-GENE-090409-3 Length:386 Species:Danio rerio

Alignment Length:506 Identity:150/506 - (29%)
Similarity:235/506 - (46%) Gaps:155/506 - (30%)


  Fly    95 ASILGLQLAVPEWEALLTALVLSVIIVLTIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVA 159
            |::|.||:::        :.:|:::.:.|.:.|..||.::|..:.|....||.|.|||..||.|:
Zfish    28 ATLLSLQISI--------SAMLAIVTLATALSNAFVIATIFLTRKLHTPANFLIGSLAATDLLVS 84

  Fly   160 LLVLPFNVAYSILGRWEFGIHLCKLWLTCDVLCCTSSILNLCAIALDRYWAITDPINYAQKRTVG 224
            :||:|.::.|::...|..|..:|.:||:.|:..||:|||:||.|||||||||||.:.|:::||:.
Zfish    85 ILVMPISIVYTVSKTWTLGQIVCDIWLSSDITFCTASILHLCVIALDRYWAITDALEYSKRRTMR 149

  Fly   225 RVLLLISGVWLLSLLISSPPLIGWNDWPDEFTSATPCEL-TSQRGYVIYSSLGSFFIPLAIMTIV 288
            |..|:|..||::|:.||.|||. |.. .......|.|.: |.|..|.:||:.|:|::|..::.|:
Zfish   150 RAALMIVIVWVISVSISLPPLF-WRQ-AKAHEELTECMVNTDQISYTLYSTFGAFYVPTVLLMIL 212

  Fly   289 YIEIFVATRRRL-RERARANKLNTIALKSTELEPMANSSPVAASNSGSKSRLLASWLCCGRDRAQ 352
            |..|:||.|.|: :..|.:.|      :.|..:.:.||:              .|.||       
Zfish   213 YGRIYVAARSRIFKTPATSGK------RFTAAQLIQNSA--------------GSSLC------- 250

  Fly   353 FATPMIQNDQESISSETHQPQDSSKAGPHGNSDPQQQHVVVLVKKSRRAKTKDSIKHGKTRGGRK 417
                       |::|.::|                                              
Zfish   251 -----------SLNSTSNQ---------------------------------------------- 258

  Fly   418 SQSSSTCEPHGEQQLLPAGGDGGSCQPGGGHSGGGKSDAEISTESGSDPKGCIQVCVTQADEQTS 482
                   |.|     |.|||.|||   |||..|||.|  .:.|.|         |.|..||.   
Zfish   259 -------EGH-----LNAGGGGGS---GGGGGGGGGS--PLFTNS---------VKVKLADS--- 294

  Fly   483 LKLTPPQSSTGVAAVSVTPLQKKTSGVNQFIEEKQKISLSKERRAARTLGIIMGVFVICWLPFFL 547
                                          :.|::::..::|::|.:|||||:|.|::||||||:
Zfish   295 ------------------------------VLERKRLCAAREKKATKTLGIILGAFIVCWLPFFV 329

  Fly   548 MYVILPFCQTCCPTNKFKNFITWLGYINSGLNPVIYTIFNLDYRRAFKRLL 598
            ..:::..|:.|.......:..|||||:||.:||||||.||.|:::||.:|:
Zfish   330 FTLVMGVCKDCWYHPVLFDVFTWLGYLNSLINPVIYTAFNDDFKQAFHKLI 380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 55/130 (42%)
7tm_1 126..>293 CDD:278431 69/167 (41%)
htr1dNP_001139158.1 7tm_1 52..365 CDD:278431 135/457 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H20240
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.