DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and Oamb

DIOPT Version :8

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001262774.1 Gene:Oamb / 43982 FlyBaseID:FBgn0024944 Length:751 Species:Drosophila melanogaster

Alignment Length:644 Identity:188/644 - (29%)
Similarity:252/644 - (39%) Gaps:191/644 - (29%)


  Fly    85 ECEGAVEELHASILGLQLAVPEWEA---LLTALVLSVIIVLTIIGNILVILSVFTYKPLRIVQNF 146
            |||..::.:            :|..   |::..||..|.||.|.||.|||.:||....||.|.||
  Fly     5 ECEDLIKSV------------KWTEPANLISLAVLEFINVLVIGGNCLVIAAVFCSNKLRSVTNF 57

  Fly   147 FIVSLAVADLTVALLVLPFNVAYSILGRWEFGIHLCKLWLTCDVLCCTSSILNLCAIALDRYWAI 211
            |||:||||||.|.|.||||:..:.:...|.||...|::||..||..||:||||||||:||||.|:
  Fly    58 FIVNLAVADLLVGLAVLPFSATWEVFKVWIFGDLWCRIWLAVDVWMCTASILNLCAISLDRYVAV 122

  Fly   212 TDPINYAQKRTVGRVLLLISGVWLLSLLISSPPLIGWNDW------------------------- 251
            |.|:.|....:..:...||:|:|:||..|..|||:||.|.                         
  Fly   123 TRPVTYPSIMSTKKAKSLIAGIWVLSFFICFPPLVGWKDQKAVIQPTYPKGNHTLYYTTTMSSSE 187

  Fly   252 ----------------------------------------------------------------- 251
                                                                             
  Fly   188 DGQLGLDSIKDQGEASLPPSPPHIGNGNAYNPYDPGFAPIDGSAEIRIAAIDSTSTSTTATTTTT 252

  Fly   252 -----------------------PDEFTSATP--CELTSQRGYVIYSSLGSFFIPLAIMTIVYIE 291
                                   |...:.:.|  ||||:.||||:||:||||:||:.:|...|..
  Fly   253 ASSSSTTETEMDLDLLNAPPQNRPQTISGSCPWKCELTNDRGYVLYSALGSFYIPMFVMLFFYWR 317

  Fly   292 IFVATRRRLRERARANKLNTIALKSTELEPMANSSPVAASNSGSKSRLLASWLCCGRDRAQFATP 356
            |:       |...|..:......|:|:          .:...||:.......|...|.|.     
  Fly   318 IY-------RAAVRTTRAINQGFKTTK----------GSKGIGSRFEEQRLTLRIHRGRG----- 360

  Fly   357 MIQNDQESISSETHQPQDSSKAGPHGNSDPQQQHVVVLVK-KSRRAKTKDSIKHGKTRGGRKSQS 420
              .|.|:|:.|   .....|.....|...|::     |.| .:||....|.||            
  Fly   361 --SNQQDSMHS---NGSTQSTTTTLGTPSPER-----LSKYATRRLHHHDKIK------------ 403

  Fly   421 SSTCEPHGEQQLLPAG-GDGGSCQPGGG------HSGG--GKSDAEISTESGSDPKGCIQVCVTQ 476
            .|...|..|.....|| ||.|..:...|      |..|  |:...|..........|....|..|
  Fly   404 ISVSYPSSENISELAGHGDVGHERRQSGNALFAVHYNGTNGRESTESQLYRQQQQHGVASSCYLQ 468

  Fly   477 ADEQTSLKLTPPQSSTGVAAVS--VTPLQKKTSGVNQFIEEKQKISLSKERRAARTLGIIMGVFV 539
            ..:... :|...||:|..|..|  ..|..||....|...:.|:   ...|.:||:||.||:|:|:
  Fly   469 VGKGLP-ELARRQSNTSEAGGSGHSRPANKKMGRRNIKAQVKR---FRMETKAAKTLAIIVGMFI 529

  Fly   540 ICWLPFFLMYVILPFCQTCCPTNKFKNFITWLGYINSGLNPVIYTIFNLDYRRAFKRLL 598
            .||.|||.||:|.||||.|.....| :.:.||||.||.:||:||.:|:.|:|.||||::
  Fly   530 FCWCPFFTMYIIRPFCQDCVDPLLF-SVLFWLGYCNSAVNPMIYALFSKDFRFAFKRII 587

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 66/130 (51%)
7tm_1 126..>293 CDD:278431 86/281 (31%)
OambNP_001262774.1 7tm_4 29..>154 CDD:304433 64/124 (52%)
7tm_1 37..>181 CDD:278431 66/143 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C123107338
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.