DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and CG12290

DIOPT Version :8

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001287540.1 Gene:CG12290 / 43182 FlyBaseID:FBgn0039419 Length:798 Species:Drosophila melanogaster

Alignment Length:512 Identity:104/512 - (20%)
Similarity:190/512 - (37%) Gaps:139/512 - (27%)


  Fly   186 LTCDVLCCTSSI--LNLCAIALDRYWAITDPINYAQKRTVGRVLLLISGVWLLSLLISSPPLIGW 248
            |.|..:..|:::  |.:..:..|.:.|:|||:.|..:.:..:..:.|:..|::.:|..:......
  Fly   168 LRCWSIDMTAALGALAVLLVVGDTWCAVTDPLRYHSRISGVKTWIFIALTWVVGILFGALSAFRV 232

  Fly   249 NDWPDE--FT-----SATPCELTSQRGY--VIYSSLGSFFI-----PLAIMTIVYIEIFVATR-- 297
            .|:..:  |:     :.|...::|....  |:|:|:  :||     |...:..:|..||...|  
  Fly   233 LDFEADALFSRQRRLAVTYFNISSTNSIFGVVYASV--YFIVIILLPFGFVCGMYWRIFSEARGN 295

  Fly   298 -RRLRERARA----NKLN-TIALKSTELEPMANS------SPVAASNSGSKSRL----------- 339
             .|:|:...:    :.|| |...::.:....:||      |..:||:.|..|.|           
  Fly   296 GLRMRQNGSSPLLQSALNLTAGQQAAQANQFSNSLCVHRHSISSASSHGGNSSLGLGGLQMQIDQ 360

  Fly   340 ----LASWLCCGRD-RAQFATPMIQNDQESISSETHQPQDSSKAGPHGNSDPQQQHVVVL----- 394
                .:|..|..|| .|:...|.|.:|..| .:|:...........|..||..|..::.|     
  Fly   361 RQQPRSSPSCLRRDSAAKVLLPTISDDGGS-DAESGAGVQLMPVQEHSLSDRNQNIMLTLQTASG 424

  Fly   395 -VKKSRRAK--------TKDSIKHGKTRGGRKSQSSSTCEPHGEQQLLPAGGDGGSCQPGGGHSG 450
             :|::..|:        ::|..:..:.:|.|:..||.....:.|.:     .|..|.:.|..|..
  Fly   425 EIKRNYSARQLPLLGTSSQDLRETNRLQGIRQVHSSPNLHKYTELR-----QDSLSEECGSPHLL 484

  Fly   451 GGKSDAEISTESGSDPKGCIQVCVTQADEQTSLKL------------------TPPQSSTG---- 493
            |.                      .|..:|..|.|                  :|.....|    
  Fly   485 GH----------------------AQRQQQQQLHLQHQQQQHHHHQQHHPHFSSPRHQQHGHALQ 527

  Fly   494 VAAVSVTP--------LQKKTSGVNQFIEEKQKISLSKERRAARTLGIIMGVFVICWLPFFLMYV 550
            :.|:..:|        |:.:.|..:...:.::      |.||||...:::.:||:.:|||.|:.:
  Fly   528 IPAIHASPKALSYMSSLRHRLSNASSLFKYRE------ESRAARISILVVVMFVVSYLPFGLLVL 586

  Fly   551 ILPFCQTCCPTNKFKN------FITWLGYINSGLNPVIYTIFNLDYRRAFKRLLGLN 601
            :    |:......|..      |:..|..::|   |.|:...|...||..|||.||:
  Fly   587 L----QSRLSAANFGGSSQLAIFMILLANLSS---PFIFAYRNKRVRRGVKRLFGLD 636

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 13/59 (22%)
7tm_1 126..>293 CDD:278431 24/122 (20%)
CG12290NP_001287540.1 7tm_1 <190..>305 CDD:278431 25/116 (22%)
7tm_1 <537..617 CDD:278431 19/92 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24248
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.