DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and TyrR

DIOPT Version :8

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001287381.1 Gene:TyrR / 42136 FlyBaseID:FBgn0038542 Length:631 Species:Drosophila melanogaster

Alignment Length:669 Identity:202/669 - (30%)
Similarity:300/669 - (44%) Gaps:144/669 - (21%)


  Fly     8 LFVNVTTTVAAAALTAAAAVSTTKS---GSGNAARGYTDS----DDDAGMGT--EAVANISGSLV 63
            |.:|..:.:..:.:..||:.|:.:.   |||....|..::    .:|||.||  ..|..:.|...
  Fly     5 LQLNNLSAIYPSLMYVAASSSSLRGLGLGSGVGVGGLPENISIVYEDAGNGTGGGGVGGVGGGYP 69

  Fly    64 EG--------LTT--VTAALSTAQADKDSAGECEGAVEELHASILGLQLAVPEWEALLTALVLSV 118
            .|        ||.  .||.::|.....:||...|.|    |...|     |..|:.::...|.:.
  Fly    70 SGPNGTDAVALTEPGPTAPVTTFNYYNESAAAAEWA----HFYDL-----VLSWQGIILIAVFAT 125

  Fly   119 IIVLTIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVALLVLPFNVAYSILGRWEFGIHLCK 183
            .||:|:|||.||||::.|.:.||.:.|.|::|||||||.|.:.|:|..||..::|.|:.|..||.
  Fly   126 FIVVTVIGNTLVILAILTTRRLRTITNCFVMSLAVADLLVGIFVMPPAVAVHLIGSWQLGWVLCD 190

  Fly   184 LWLTCDVLCCTSSILNLCAIALDRYWAITDPINYAQKRTVGRV-LLLISGVWLLSLLISSPPLIG 247
            :|::.|||.||:|||:||||::|||.|:|.|:.|::||...|: |::|..||||:|.|:.||::|
  Fly   191 IWISLDVLLCTASILSLCAISVDRYLAVTRPLTYSRKRRSKRLALIMILIVWLLALAITCPPMLG 255

  Fly   248 WNDWPDEFTSATPCELTSQRGYVIYSSLGSFFIPLAIMTIVY--IEIFVATRRRLRERARANKLN 310
            |.: |.. .....|......||||:|::||||||:|:|..||  |...:|:|.            
  Fly   256 WYE-PGR-RDLRECRYNQNEGYVIFSAMGSFFIPMAVMIYVYARISCVIASRH------------ 306

  Fly   311 TIALKSTELEPMANSSPVAASNSGSKSRLLASWLCCGRDRAQFATPMIQN---DQESISSETHQP 372
                        .|.:.::..|...|               ::....::|   :||..|| ..|.
  Fly   307 ------------DNMTDISVHNKKFK---------------RYTAADVENELSEQEQHSS-VGQR 343

  Fly   373 QDSSKAGPHGNSDPQQQHVVVLVKKSRRAKTKDS-----IKHGKTRGGRKSQSSSTCEPHGEQQL 432
            |..:.:....|.        .:.|:.:.....||     :..|...||....||:|...|.:..|
  Fly   344 QRQATSRTFSNQ--------TIAKELQDMMLSDSDNCAAMGAGGAGGGGGGASSATGGTHCQSLL 400

  Fly   433 -LPAGGDGGS--CQPGGGH----------------------SGGGKSDAEISTESGSDPKGCIQV 472
             ||:||.|||  |...|.:                      ||.|...:.:..:..|.|.|    
  Fly   401 ALPSGGVGGSMGCAKNGCYELTRPSSLKRASTASTTITTMTSGMGPGSSLLDAQWQSQPPG---- 461

  Fly   473 CVTQADEQTSLKLTPPQS-----STG------------------VAAVSVTPLQKKTS-GVNQFI 513
              .....||.....||::     |.|                  .|.|:.|.....|| ..|...
  Fly   462 --QTGQVQTHSLSQPPRTHSFRHSHGERDRERLRSHHHHPHYHHQAGVTTTSTSGNTSANTNSKS 524

  Fly   514 EEKQKISLSKERRAARTLGIIMGVFVICWLPFFLMYVILPFCQTCCPTNKFKNFITWLGYINSGL 578
            ...:..||.||.:..:||.|::|.|:.||||||:.|:|.||......:......:||||:.||.:
  Fly   525 LSNRITSLKKENKTTQTLSIVVGGFIACWLPFFINYLITPFLAEHQASQMLAKALTWLGWFNSAI 589

  Fly   579 NPVIYTIFNLDYRRAFKRL 597
            ||.||..:::|:|.||.||
  Fly   590 NPFIYAFYSVDFRAAFWRL 608

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 64/131 (49%)
7tm_1 126..>293 CDD:278431 81/169 (48%)
TyrRNP_001287381.1 7tm_4 127..>249 CDD:304433 62/121 (51%)
7tm_1 133..>298 CDD:278431 80/166 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C123107597
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24248
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.