DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and TyrRII

DIOPT Version :8

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001262682.1 Gene:TyrRII / 42135 FlyBaseID:FBgn0038541 Length:586 Species:Drosophila melanogaster

Alignment Length:660 Identity:178/660 - (26%)
Similarity:266/660 - (40%) Gaps:191/660 - (28%)


  Fly    18 AAALTAAAAVSTTKSGS-----GNAARGYTDSDDDAGMGTEAVANISGSLVEGLTTVTAALSTAQ 77
            :.|||.|:..|.:..|:     .:||.|.......||.|...|.:::..||          |.| 
  Fly    18 STALTVASGNSNSSDGTLLLIQTSAAPGGDVMATGAGAGKLGVPSMNSYLV----------SMA- 71

  Fly    78 ADKDSAGECEGAVEELHASILGLQLAVPEWEALLTALVLSVIIVLTIIGNILVILSVFTYKPLRI 142
                                         |...|...|..|||::|::||.||||:|.|.:.||.
  Fly    72 -----------------------------WPKSLAVAVFLVIILVTVVGNTLVILAVLTTRRLRT 107

  Fly   143 VQNFFIVSLAVADLTVALLVLPFNVAYSILGRWEFGIHLCKLWLTCDVLCCTSSILNLCAIALDR 207
            |.|.|:::||:.|..|...|:|.:|...|.|.|.||..||.:|::.|:|.|:.|||:||||:|||
  Fly   108 VTNCFVMNLAITDWLVGTCVMPPSVVLYITGTWRFGWILCDIWISLDILLCSGSILSLCAISLDR 172

  Fly   208 YWAITDPINYAQKRTVGRV-LLLISGVWLLSLLISSPPLIGWNDWPDEFTSATPCELTSQRGYVI 271
            |.|:|.|:.|::||...|: ||:|..||:.:|.|:.||.:||.:..........|.....:|||:
  Fly   173 YLAVTQPLTYSKKRRSKRLALLMILVVWITALSITCPPYLGWYEVGRHQAEFVDCRYNQNKGYVV 237

  Fly   272 YSSLGSFFIPLAIMTIVYIEI-FVATRRRLR---------------------------------- 301
            :|::|||||||.:|..||::| :|.|.||.|                                  
  Fly   238 FSAMGSFFIPLTVMLYVYVKIGYVLTSRRQRIVRDAYSERTADYDVDGDNFISESEHYHCTPTKW 302

  Fly   302 -----ERARANKLNTIALKSTELEPMANSSPVAASNSGSKSRLLASWLCCGRDRAQFAT------ 355
                 .|.|.|.|:             :..|.||:|:.:|.. .:|..|....:...||      
  Fly   303 LPNRKSRWRFNSLH-------------DPPPSAATNAAAKGH-QSSVKCSKCSKCSSATGTAGAG 353

  Fly   356 ---------------PMIQN--DQESISSETHQPQDSSK-AGPHGNSDPQQQHVVVLVKKSRRAK 402
                           |....  :...:||..|....|.| .||..:|.|...|.|          
  Fly   354 AGAGVVDKTLTFKHQPTFYELVEVSRLSSLIHCSAISCKYGGPCMHSTPSGMHYV---------- 408

  Fly   403 TKDSIKHGKTRGGRKSQSSSTCEPHGEQQLLPAGGDGGSCQPGGGHSGGGKSDAEISTESG---- 463
                        |.::..|.||                        .||..|:...:|.:.    
  Fly   409 ------------GTEASFSDTC------------------------LGGNVSNNTTTTTTNTVAL 437

  Fly   464 -SDPKGCIQVCVTQADEQTSLKLTPPQS----STGVAAVSVTPLQKKTSGVNQFIEEKQKISLSK 523
             ::.|...:....|..:::|.....|.:    |.|           :.|..|.......::|.:|
  Fly   438 ETNEKLEAEAKQKQQQQRSSFDHHHPHAHHHGSHG-----------QQSHHNHHHRMPMRVSTTK 491

  Fly   524 -ERRAARTLGIIMGVFVICWLPFFLMYVILPFCQTCCPTNKFKNFITWLGYINSGLNPVIYTIFN 587
             :.:.|:||.|:||..:.||||||:.|:::||..............||:|::|..:||.||..:|
  Fly   492 RDSKTAKTLTIVMGGLIACWLPFFVYYLLIPFLPRPAVLEDLMFGFTWIGWVNCAINPFIYAFYN 556

  Fly   588 LDYRRAFKRL 597
            .|:|.||.||
  Fly   557 PDFRTAFWRL 566

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 61/131 (47%)
7tm_1 126..>293 CDD:278431 76/168 (45%)
TyrRIINP_001262682.1 7tm_4 82..>212 CDD:304433 62/129 (48%)
7tm_1 91..>277 CDD:278431 81/185 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C123107639
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24248
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.