DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and Octbeta3R

DIOPT Version :8

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster

Alignment Length:1227 Identity:220/1228 (18%)
Similarity:327/1228 (27%) Gaps:652/1228 (53%)


  Fly     3 SADQILFVNVTTTVAAAALTAAAAVSTTKSGSGNAARGYTD----------SDDDAGMGTEAVAN 57
            ||.....:...|.....:.||||..:||.:.|......:.|          :..||...:...:.
  Fly    33 SATNASHLQPATLTGHISTTAAAKTTTTPTSSLPITSQFVDASLTSLSLTATSSDASYSSPFSSY 97

  Fly    58 ISG-SLVEGLTTV----TAALSTAQADKDSAGECEGAVEELHASILGLQLAVPEWEALLTALVLS 117
            :|. |..|.|:||    ||..|....|..:         ||..|.|.|.|      .||...:.|
  Fly    98 LSSDSTFELLSTVGPNITANGSDIAVDNQA---------ELEESWLDLSL------LLLKGFIFS 147

  Fly   118 VIIVLTIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVALLVLPFNVAYSIL-GRWEFGIHL 181
            .||:..::||.|||:||...:.||::.|:|:||||:||:.|||..:.||.:..:. |:|.||..:
  Fly   148 SIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFNASVELSGGKWMFGPFM 212

  Fly   182 CKLWLTCDVLCCTSSILNLCAIALDRYWAITDPINYAQKRTVGRVLLLISGVWLLSLLISSPPL- 245
            |.::.:.||...|:|||:||.|::|||:||..|:.|....|...|..:::.||:|..|||..|: 
  Fly   213 CNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALISFTPIF 277

  Fly   246 IGW----------NDWPDEFTSATPCELTSQRGYVIYSSLGSFFIPLAIMTIVYIEIFVATRRRL 300
            :||          :..||:      |.....:.|.:.||..||:||..:|.::|..||....|:.
  Fly   278 LGWYTTEEHLREISLHPDQ------CSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQR 336

  Fly   301 RERARANK---LNTIALKSTE----------------------------------LEPMANSS-- 326
            :..:|.:.   ||::.:..|:                                  |:|..:..  
  Fly   337 KALSRTSSNILLNSVHMGHTQQPTSLSYLHPSDCDLNATSAREETHSALSNLEDMLQPATDEDDD 401

  Fly   327 -------------PVAASNSGSKSRLL--------------ASWLCCGRDR---------AQFAT 355
                         |...|.|....|.|              .|.:...:.:         |....
  Fly   402 RDECDELRVPSPPPRRLSRSSIDLRDLEQERYEKVTHTDSAPSMMALQQQQPSHNQLQPPAPVFN 466

  Fly   356 PMIQNDQESISSETHQPQDSSKAGPH---------GNSDPQQQHVVVLV---------------- 395
            |.|..:.:.|.|:....:.|...||.         |||:|:.:.....|                
  Fly   467 PQIWTEGKMIPSKELDKEHSHPNGPQQQLSLTSGSGNSEPEPESTAYRVFGGLNSDESEGNDLYD 531

  Fly   396 --------KKSRRAKTKDS-------------------------------IKHGKTRGGRKSQSS 421
                    .|..:...:|:                               :|.|....|||:.:|
  Fly   532 THLPLAEDNKELKRLIEDNYLYFKRQTGGTIISGPGGGKYAALSETDFIRLKAGAAACGRKAFAS 596

  Fly   422 STCE---PHGEQQLLP------------------------------------AGGDGGSCQPGG- 446
            |..|   ...|.:.||                                    |..:|.|..... 
  Fly   597 SDSEFLRTISESRALPEQPVPGKEKGFNILSLLSKTKRSSTECFTLEKKRHQANSEGSSFFRRSR 661

  Fly   447 ----GHS----GGGK-----------SDAE--------------ISTESGS-------------- 464
                .||    ||||           ||.:              :|.:||:              
  Fly   662 NRKLSHSYNGCGGGKERKLERRQRQHSDTDSTPNKPDILLDINVLSEQSGASVIQQFSDGVQLID 726

  Fly   465 --------------------------------------------DPKGCI--------------- 470
                                                        :|.|.:               
  Fly   727 FSELKTPPERIRSDDELAQLADCFGESPQQPATPPPSLSPPELPEPSGLLIASSSELAEIFRSLS 791

  Fly   471 ------------------QVC-------------------------------------------- 473
                              |||                                            
  Fly   792 FPLGRPAGAPQRLSTLSDQVCANYLMSPPNTPAPPAISVPNGGAMDSSASSNAQSASINVYFLSP 856

  Fly   474 ---------------VTQADEQTSLKLTPP----------------------------------- 488
                           ....|..|||.:..|                                   
  Fly   857 PPHAAAPGYTPSDTSTVSLDVVTSLPMPVPVPQPNPQMASQSNISPKPEIILDSTLSPVEGCGDE 921

  Fly   489 -----------QSSTGVAAVSVT------------------------------------------ 500
                       :.|.|.|.|||:                                          
  Fly   922 HRDVTSPLFKRKDSAGDADVSVSGNGGAGGVGGVGGRQGRCSILAGYDGIQTVRKRQASVVTYDV 986

  Fly   501 ----------------PLQK-----------------KTSGVNQFIEEKQ--------------- 517
                            |:.:                 :..|:..|::|::               
  Fly   987 NVINFSQENSDSRSYIPMGRVSTSSAKHEFSNKSSLIRRGGICIFVDEEEAEIIEQRPRGITFAA 1051

  Fly   518 -------------------------------------------KISLSK---------------- 523
                                                       |.|:.:                
  Fly  1052 VPSPLPKCPLCGADISSTTGTTANATATANADSTIDTTVTTSSKRSIHEQTPDLGQRPASSSSST 1116

  Fly   524 ----------------------------------------------ERRAARTLGIIMGVFVICW 542
                                                          |.:||||||||||||::||
  Fly  1117 RFWHKRTAAVTACWQQSKNRKRRFKTGCSHCGATGGSVRPAKGWKAEHKAARTLGIIMGVFLLCW 1181

  Fly   543 LPFFLMYVILPFCQTCCP-TNKFKNFITWLGYINSGLNPVIYTIFNLDYRRAFKRLL 598
            |||||.|||...|...|| .:.....:.|:||.||.|||:||..||.|:|.||:..|
  Fly  1182 LPFFLWYVITSLCGPACPCPDVLVVVLFWIGYFNSTLNPLIYAYFNRDFREAFRNTL 1238

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 54/132 (41%)
7tm_1 126..>293 CDD:278431 67/179 (37%)
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 73/206 (35%)
7tm_1 156..>344 CDD:278431 70/194 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C123106295
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24248
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.