DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and CG13579

DIOPT Version :8

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001261169.1 Gene:CG13579 / 37905 FlyBaseID:FBgn0035010 Length:716 Species:Drosophila melanogaster

Alignment Length:545 Identity:113/546 (21%)
Similarity:192/546 (35%) Gaps:152/546 (28%)


  Fly    70 TAALSTAQADKDSAGECEGAVEELHASILGLQLAVPEWEALLTALVLSVIIVLTIIG-NILVILS 133
            |.:|..|.|.|:|:  |.......|..|..:.:|    |.:...|:|  ::.|.:|| |.|||..
  Fly     5 TGSLLVAPAVKNSS--CSHPRYSGHNFIAHIGIA----ETIEAVLIL--VLTLGVIGANCLVIFV 61

  Fly   134 VFTYKPLRIVQ---NFFIVSLAVADLTVALLVLPFNVAYSILGRWEFGIHLCKLW-LTCDVLCCT 194
            :...:....:.   .:.:.|||:.|||:.||:.||.:..::...|.:|...|::. |....|...
  Fly    62 INNRRYAAYIHQQPRYLLTSLALNDLTIGLLITPFGLMPALFHCWPYGEIFCQIQALLRGALSQQ 126

  Fly   195 SSILNLCAIALDRYWAITDPINYAQKRTVGRVLLLISGVWLLSLLISSPPLIGWNDWPDEF---- 255
            |:::.:| :|:|||.....|..|.|..:....:.::|..|::||.:     .|:...|..:    
  Fly   127 SAVILVC-MAVDRYMCALHPRRYYQHSSKKGCVAILSLTWIISLTV-----FGFLVLPKGYYFNN 185

  Fly   256 TSATPCE-LTSQRGYVIYSSLGSFFIPLAIMTIVYIEIFVATRRRLRERARANKLNTIALKSTEL 319
            |....|| ..|:..|.|.|:...:|....::...|...|..:|.||.:       .|:.|.:...
  Fly   186 TGLMACEPFYSKPSYRILSTCALYFPTTMVLMYCYGSSFHMSRFRLND-------PTMPLTAAAH 243

  Fly   320 EPMANSSPVAASNSGSKSRLLASWLCCGRDRAQFATPMIQNDQESISSETHQPQDSSKAGPHGNS 384
            .|..:..|.||                                :.:....|| |...:||.|.: 
  Fly   244 HPHPHPHPTAA--------------------------------QQLQMHQHQ-QHHQQAGMHSH- 274

  Fly   385 DPQQQHVVVLVKKSRRAKTKDSIKHGKTRGGRKSQSSSTCEP--HGEQQLLPAGGDGGSCQPGGG 447
                                  :.||.:.  ..|..|....|  ||...                
  Fly   275 ----------------------LYHGHSH--HPSHPSHPNHPNHHGHPH---------------- 299

  Fly   448 HSGGGKSDAEISTESGSDPKGCIQVCVTQADEQTSLKLTPPQSSTGVAAVSVTPLQKKTSGVNQF 512
                         ..|....|.:.:.:       |:.|....:.|......:.|:|:|.|.    
  Fly   300 -------------HHGPPVMGHLSMAM-------SMGLAGMPNMTNKITKKIVPIQEKNSS---- 340

  Fly   513 IEEKQKISLSKERRAARTLGIIMGVFVICWLPFFLMYVILPFCQTCCPTNKFKNF----ITWLGY 573
                   ..:....||.:||     |::...|:.:..::     |.|..:|...|    :||...
  Fly   341 -------GSTSRSMAAISLG-----FIVMVTPWTIQEIV-----TACTGSKLPPFLDFLVTWTAL 388

  Fly   574 INSGLNPVIYTIFNLDYRRAFKRLL 598
            .||..||.:|.:.|.|:||..::|:
  Fly   389 SNSLWNPFMYWLLNSDFRRMSRQLM 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 37/136 (27%)
7tm_1 126..>293 CDD:278431 44/177 (25%)
CG13579NP_001261169.1 7tm_4 51..>148 CDD:304433 28/98 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C123106870
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.