DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and 5-HT1B

DIOPT Version :8

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001137708.2 Gene:5-HT1B / 37191 FlyBaseID:FBgn0263116 Length:629 Species:Drosophila melanogaster

Alignment Length:567 Identity:178/567 - (31%)
Similarity:266/567 - (46%) Gaps:115/567 - (20%)


  Fly   103 AVPEW---EALLTALVLSVIIVLTIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVALLVLP 164
            ||..|   :.:..|:||.::|::|||||:.||.::...:.|:.|.|:.:.|||||||.||.||:|
  Fly    81 AVEFWLLVKMIAMAVVLGLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMP 145

  Fly   165 FNVAYSILGRWEFGIHLCKLWLTCDVLCCTSSILNLCAIALDRYWAITDPINYAQKRTVGRVLLL 229
            ....|.|...|..|..||.:|.:|||||||:|||:|.|||.||||.:|: |:|...||..||.|:
  Fly   146 LGAVYEISNGWILGPELCDIWTSCDVLCCTASILHLVAIAADRYWTVTN-IDYNNLRTPRRVFLM 209

  Fly   230 ISGVWLLSLLISSPPLIGWNDWPD--EFTSATPCELTSQRGYVIYSSLGSFFIPLAIMTIVYIEI 292
            |..||..:|::|..|..||.| ||  :......|.::...||.|:::..:|::||.::..:|.:|
  Fly   210 IFCVWFAALIVSLAPQFGWKD-PDYMKRIEEQHCMVSQDVGYQIFATCCTFYVPLLVILFLYWKI 273

  Fly   293 FVATRRRLRERARANKLNTIA------------------------LKSTELEPM----------- 322
            ::..|:|::.||:.:...|:.                        |::.|..|:           
  Fly   274 YIIARKRIQRRAQKSFNVTLTETDCDSAVRELKKERSKRRAERKRLEAGERTPVDGDGTGGQLQR 338

  Fly   323 -------------ANSSPVAASNSGSKSRLLA------SWLCCGRDRAQFATPMIQNDQESISSE 368
                         .|::.|.|.:.|:.:|.:|      :.|...|:..:|:|....|...   :.
  Fly   339 RTRKRMRICFGRNTNTANVVAGSEGAVARSMAAIAVDFASLAITREETEFSTSNYDNKSH---AG 400

  Fly   369 THQPQDSSKAGPHGNSDPQQ------------QHVVVLVKKSRRAKTKDSIKHGKTRGGRKSQSS 421
            |.....||.|..:..|:..:            ||.::....:.......||    ..||....::
  Fly   401 TELTTVSSDADDYRTSNANEIITLSQQVAHATQHHLIASHLNAITPLAQSI----AMGGVGCLTT 461

  Fly   422 STCEPHGEQQLLPAGGDGGSCQPGGGHSGGGKSDAEISTESGSDPKGCIQVCVTQADEQTSLKLT 486
            :|   ..|:.|..||...|:. .||..||.|:..|  .||..:...|.                 
  Fly   462 TT---PSEKALSGAGTVAGAV-AGGSGSGSGEEGA--GTEGKNAGVGL----------------- 503

  Fly   487 PPQSSTGVAAVSVTPLQKKTSGVNQFIEEKQKISLSKERRAARTLGIIMGVFVICWLPFFLMYVI 551
                 .||.|....|.||       ..:.:|.:...:||:||:||.||.|.|||||||||:|.:.
  Fly   504 -----GGVLASIANPHQK-------LAKRRQLLEAKRERKAAQTLAIITGAFVICWLPFFVMALT 556

  Fly   552 LPFCQTCCPTNKFKNFITWLGYINSGLNPVIYTIFNLDYRRAFKRLL 598
            :..|:.|.......:...||||.||.||||||||||.::||||||:|
  Fly   557 MSLCKECEIHTAVASLFLWLGYFNSTLNPVIYTIFNPEFRRAFKRIL 603

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 64/130 (49%)
7tm_1 126..>293 CDD:278431 71/168 (42%)
5-HT1BNP_001137708.2 7tm_1 107..>288 CDD:278431 76/182 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BCYC
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.