DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and HTR1A

DIOPT Version :8

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_000515.2 Gene:HTR1A / 3350 HGNCID:5286 Length:422 Species:Homo sapiens

Alignment Length:492 Identity:164/493 (33%)
Similarity:239/493 (48%) Gaps:116/493 (24%)


  Fly   110 LLTALVLSVIIVLTIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVALLVLPFNVAYSILGR 174
            ::|:|:|..:|...::||..|:.::...:.|:.|.|:.|.||||.||.|::||||....|.:|.:
Human    37 VITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNK 101

  Fly   175 WEFGIHLCKLWLTCDVLCCTSSILNLCAIALDRYWAITDPINYAQKRTVGRVLLLISGVWLLSLL 239
            |..|...|.|::..||||||||||:||||||||||||||||:|..|||..|...|||..||:..|
Human   102 WTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFL 166

  Fly   240 ISSPPLIGWNDWPDEFTSATPCELTSQRGYVIYSSLGSFFIPLAIMTIVYIEIFVATRRRLRERA 304
            ||.||::||.. |::.:....|.::...||.|||:.|:|:|||.:|.::|..||.|.|.|:|:  
Human   167 ISIPPMLGWRT-PEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRK-- 228

  Fly   305 RANKLNTIALKSTELEPMANSSPVAASNSGSKSRLLASWLCCGRDRAQFATPMIQNDQESISSET 369
                    .:|..|             .:|:.:|..||                           
Human   229 --------TVKKVE-------------KTGADTRHGAS--------------------------- 245

  Fly   370 HQPQDSSKAGPHGNSDPQQQHVVVLVKKSRRAKTKDSIKHGKTRGGRKSQSSSTCEPHGEQQLLP 434
              |....|...:|.|..:...:.|..|                .||      :.|.....:|   
Human   246 --PAPQPKKSVNGESGSRNWRLGVESK----------------AGG------ALCANGAVRQ--- 283

  Fly   435 AGGDGGSCQPGGGHS-GGGKSDAEISTESGSDPKGCIQVCVTQADEQTSLKLTPPQSSTGVAAVS 498
             |.||.:.:....|. |..|....:.:|:|..|  |......:.:|:.:                
Human   284 -GDDGAALEVIEVHRVGNSKEHLPLPSEAGPTP--CAPASFERKNERNA---------------- 329

  Fly   499 VTPLQKKTSGVNQFIEEKQKISLSKERRAARTLGIIMGVFVICWLPFFLMYVILPFCQTCC--PT 561
                           |.|:|::|::||:..:|||||||.|::||||||::.::||||::.|  ||
Human   330 ---------------EAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPT 379

  Fly   562 NKFKNFITWLGYINSGLNPVIYTIFNLDYRRAFKRLL 598
             .....|.||||.||.||||||..||.|::.|||:::
Human   380 -LLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKII 415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 67/131 (51%)
7tm_1 126..>293 CDD:278431 82/167 (49%)
HTR1ANP_000515.2 7tm_4 48..>169 CDD:304433 63/121 (52%)
7tm_1 53..400 CDD:278431 153/460 (33%)
Agonist binding. {ECO:0000250} 112..121 5/9 (56%)
DRY motif, important for ligand-induced conformation changes. {ECO:0000250} 133..135 2/2 (100%)
Agonist binding. {ECO:0000250} 358..362 4/4 (100%)
NPxxY motif, important for ligand-induced conformation changes and signaling. {ECO:0000250} 396..400 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BCYC
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133249
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.