DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and adra2db

DIOPT Version :8

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_919346.1 Gene:adra2db / 266755 ZFINID:ZDB-GENE-021010-5 Length:415 Species:Danio rerio

Alignment Length:536 Identity:159/537 (30%)
Similarity:247/537 (46%) Gaps:133/537 (25%)


  Fly    66 LTTVTAALSTAQADKDSAGECEGAVEELHASILGLQLAVPEWEALLTALVLSVIIVLTIIGNILV 130
            |:|:|..|..:..|.:.............||:             |..||::|||::||:||:||
Zfish     3 LSTITFLLPNSSEDTNGTSAPRLPPHSQCASV-------------LIVLVVTVIILVTIVGNVLV 54

  Fly   131 ILSVFTYKPLRIVQNFFIVSLAVADLTVALLVLPFNVAYSILGRWEFGIHLCKLWLTCDVLCCTS 195
            :::|||.:.||..||.|:||||.||:.||.||:||::|..::|.|..|...|..:|..|||.|||
Zfish    55 VVAVFTSRALRAPQNLFLVSLAAADILVATLVIPFSLANEVMGYWYLGSTWCAFYLALDVLFCTS 119

  Fly   196 SILNLCAIALDRYWAITDPINYAQKRTVGRVLLLISGVWLLSLLISSPPLIGWNDWPDEFTSATP 260
            ||::||||:|||||::|..::|..|||..|:.::|:.||::|.:||.|||:....  ||.    .
Zfish   120 SIVHLCAISLDRYWSVTKAVSYNLKRTPRRIKIMITVVWVISAVISFPPLLMTKH--DEL----E 178

  Fly   261 CELTSQRGYVIYSSLGSFFIPLAIMTIVYIEIFVATRRRLRERARANKLNTIALKSTELEPMANS 325
            |.|.::..|::.|.:.|||.|..||.:||..|:...::|                         :
Zfish   179 CLLNNETWYILSSCIVSFFAPGLIMILVYCRIYRVAKQR-------------------------A 218

  Fly   326 SPVAASNSGSKSRLLASWLCCGRDRAQFATPMIQNDQESISS-ETHQPQDSSKAGPHGNSDPQQQ 389
            |.|..:.:|.:           |..:|..|..::..:..:.| .:|......:.|...:.|.::.
Zfish   219 STVFVAKNGME-----------RQPSQSETCFVRKGKSEVESPSSHSSGSRERKGELDDIDLEES 272

  Fly   390 HVVVLVKKSRRAKTKDSIKHGKTRGGRKSQSSSTCEPHGEQQLLPAGGDGGSCQPGGGHSGGGKS 454
            .|....:.||.||:            ||.:.:.:|.                 :|.|..|.....
Zfish   273 SVSNRHRNSRFAKS------------RKVEGAQSCP-----------------KPNGRLSWACSR 308

  Fly   455 DAEISTESGSDPKGCIQVCVTQADEQTSLKLTPPQSSTGVAAVSVTPLQKKTSGVNQFIEEKQKI 519
            .:|:..|    |:.          .|.||                               .|.|:
Zfish   309 ASELEQE----PRA----------RQLSL-------------------------------SKSKL 328

  Fly   520 SLSKERRAARTLGIIMGVFVICWLPFFLMYVILPFCQTCC--PTNKFKNFITWLGYINSGLNPVI 582
            :..:|:|....|.::|||||:||.|||..|.:...|:..|  |.:.| |...|:||.||.:||:|
Zfish   329 AQMREKRFTFVLAVVMGVFVLCWFPFFFTYSLHAICRKSCTIPDSLF-NLFFWIGYCNSSVNPII 392

  Fly   583 YTIFNLDYRRAFKRLL 598
            |||||.|:|:|||:::
Zfish   393 YTIFNRDFRKAFKKIM 408

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 67/131 (51%)
7tm_1 126..>293 CDD:278431 77/167 (46%)
adra2dbNP_919346.1 7tm_1 59..393 CDD:278431 129/451 (29%)
7tm_4 69..>226 CDD:304433 70/188 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D323202at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T596395
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24248
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.