DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and adra2da

DIOPT Version :8

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_919345.2 Gene:adra2da / 266754 ZFINID:ZDB-GENE-021010-4 Length:408 Species:Danio rerio

Alignment Length:494 Identity:158/494 - (31%)
Similarity:228/494 - (46%) Gaps:136/494 - (27%)


  Fly   114 LVLSVIIVLTIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVALLVLPFNVAYSILGRWEFG 178
            ||:|:||:|||:||:|||::|.|.:.||..||.|:||||.||:.||.||:||::|..|:|.|.||
Zfish    35 LVVSLIILLTIVGNVLVIVAVLTSRALRAPQNLFLVSLACADILVATLVIPFSLANEIMGYWYFG 99

  Fly   179 IHLCKLWLTCDVLCCTSSILNLCAIALDRYWAITDPINYAQKRTVGRVLLLISGVWLLSLLISSP 243
            ...|..:|..|||.|||||::||||:|||||::|..:.|..|||..|:..:|:.|||:|.:||.|
Zfish   100 STWCAFYLALDVLFCTSSIVHLCAISLDRYWSVTKAVRYNLKRTPRRIKCMIAVVWLISAVISFP 164

  Fly   244 PLIGWNDWPDEFTSATPCELTSQRGYVIYSSLGSFFIPLAIMTIVYIEIFVATRRRLRERARANK 308
            |||....  ||    ..|.:..:..|::.|...|||.|..||..||.:|:...::|         
Zfish   165 PLIMTKH--DE----KECLINDETWYILSSCAVSFFAPGLIMITVYCKIYRVAKQR--------- 214

  Fly   309 LNTIALKSTELEPMANSSPVAASNSGSKSRLLASWLCCGRDRAQFATPMIQNDQESISSETHQPQ 373
                            ||.|..:.:|.:           |..:|..|..::.|:           
Zfish   215 ----------------SSTVFVAKNGLE-----------RQPSQSETCFVRKDK----------- 241

  Fly   374 DSSKAGPHGNSDPQQQHVVVLVKKSRRAKTKDSI-------KHGKTRGGRKSQSSSTCEPHGEQQ 431
             ..|..|..||.          :.::|.:..|.|       ...:.||.|.|:....   .||::
Zfish   242 -FEKESPSSNSS----------ESAQRQEELDDIDLEESAASDSRARGSRFSKRRRV---EGERR 292

  Fly   432 LLPAGGDGGSCQPGGGHSGGGKSDAEISTESGSDPKGCIQVCVTQADEQTSLKLTPPQSSTGVAA 496
                 |...||:              :|..:..:| |..|                         
Zfish   293 -----GPQRSCR--------------VSWAAHQEP-GSRQ------------------------- 312

  Fly   497 VSVTPLQKKTSGVNQFIEEKQKISLSKERRAARTLGIIMGVFVICWLPFFLMYVILPFCQTCC-- 559
                          |.:..|.|::..:|:|....|.::|||||:||.|||..|.:...|...|  
Zfish   313 --------------QQLASKSKVAQMREKRFTFVLAVVMGVFVLCWFPFFFTYSLQAVCGERCGP 363

  Fly   560 PTNKFKNFITWLGYINSGLNPVIYTIFNLDYRRAFKRLL 598
            |...||.|. |:||.||.:||:||||||.|:|:|||:::
Zfish   364 PEALFKLFF-WIGYCNSSVNPIIYTIFNRDFRKAFKKVV 401

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 70/129 (54%)
7tm_1 126..>293 CDD:278431 79/166 (48%)
adra2daNP_919345.2 7tm_4 45..>183 CDD:304433 70/143 (49%)
7tm_1 47..386 CDD:278431 139/465 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D323202at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T596395
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24248
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.