DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and adra2a

DIOPT Version :8

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_997520.3 Gene:adra2a / 266750 ZFINID:ZDB-GENE-021010-1 Length:388 Species:Danio rerio

Alignment Length:497 Identity:162/497 - (32%)
Similarity:230/497 - (46%) Gaps:144/497 - (28%)


  Fly   110 LLTALVLSV----IIVLTIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVALLVLPFNVAYS 170
            ||.||.|||    :|:|.|.||:|||::|||.:.||..||.|:||||.||:.||.||:||::|..
Zfish    19 LLVALPLSVAVGLLILLIIFGNVLVIIAVFTSRALRAPQNLFLVSLASADILVATLVMPFSLANE 83

  Fly   171 ILGRWEFGIHLCKLWLTCDVLCCTSSILNLCAIALDRYWAITDPINYAQKRTVGRVLLLISGVWL 235
            ::|.|.||...|:::|..|||.||:||.:||||:|||||:||..|.|..|||..|:..:|..||:
Zfish    84 LMGMWTFGGVWCEIYLALDVLFCTASITHLCAISLDRYWSITQAIEYNLKRTPQRIKRIIFIVWI 148

  Fly   236 LSLLISSPPLIGWNDWPDEFTSATPCELTSQRGYVIYSSLGSFFIPLAIMTIVYIEIFVATRRRL 300
            ::.:||.||||....     :....|::..::.|::.|.:||||:|..||.:|||.|:...::|.
Zfish   149 IAAVISCPPLITMKK-----SEGDICDINKEKWYIVSSCIGSFFLPCIIMVLVYIRIYQIAKKRT 208

  Fly   301 RERARANKLNTIALKSTE----LEPMANSSPVAASNSGSKSRLLASWLCCGRDRAQFATPMIQND 361
            |.....::.|.:..|..:    |..:.|:.|                                :|
Zfish   209 RAPPGDHRKNEVGKKENDPHEKLNGIQNAEP--------------------------------DD 241

  Fly   362 QESISSETHQPQDSSKAGPHGNSDPQQQHVVVLVKKSRRAKTKDSIKHGKTRGGRKSQSSSTCEP 426
            ::.|:.   ...:.|.:..|..|:|     ..|.|||.:.|||.|                    
Zfish   242 KDEING---VDMEESSSSDHKVSNP-----CSLKKKSSKGKTKLS-------------------- 278

  Fly   427 HGEQQLLPAGGDGGSCQPGGGHSGGGKSDAEISTESGSDPKGCIQVCVTQADEQTSLKLTPPQSS 491
                |:.|..||              |::| ..|...|..||                       
Zfish   279 ----QIKPGDGD--------------KTEA-CQTTKASRWKG----------------------- 301

  Fly   492 TGVAAVSVTPLQKKTSGVNQFIEEKQKISLSKERRAARTLGIIMGVFVICWLPFFLMYVILPFCQ 556
                                    :|    ::|:|....|.:::|||||||.|||..|....||.
Zfish   302 ------------------------RQ----NREKRFTFVLAVVIGVFVICWFPFFFTYTFTAFCD 338

  Fly   557 TCCPTNKFKNFITWLGYINSGLNPVIYTIFNLDYRRAFKRLL 598
            .|.|...|| |..|.||.||.|||:||||||.|:||:||::|
Zfish   339 CCVPETLFK-FFFWFGYCNSSLNPIIYTIFNNDFRRSFKKIL 379

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 69/134 (51%)
7tm_1 126..>293 CDD:278431 78/166 (47%)
adra2aNP_997520.3 7tm_4 31..>165 CDD:304433 68/138 (49%)
7tm_1 39..364 CDD:278431 140/460 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D323202at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T596395
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24248
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.