DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and Adra2a

DIOPT Version :8

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_036871.3 Gene:Adra2a / 25083 RGDID:2056 Length:465 Species:Rattus norvegicus

Alignment Length:516 Identity:169/516 - (32%)
Similarity:240/516 - (46%) Gaps:130/516 - (25%)


  Fly   108 EALLTALVLSVIIVL-TIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVALLVLPFNVAYSI 171
            :..||.:.|:.:::| |:.||:|||::|||.:.|:..||.|:||||.||:.||.||:||::|..:
  Rat    46 QVTLTLVCLAGLLMLFTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEV 110

  Fly   172 LGRWEFGIHLCKLWLTCDVLCCTSSILNLCAIALDRYWAITDPINYAQKRTVGRVLLLISGVWLL 236
            :|.|.||...|:::|..|||.|||||::||||:|||||:||..|.|..|||..|:..:|..||::
  Rat   111 MGYWYFGKVWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVI 175

  Fly   237 SLLISSPPLI-------GWNDWPDEFTSATPCELTSQRGYVIYSSLGSFFIPLAIMTIVYIEIFV 294
            |.:||.||||       |....|.|    ..|::..|:.|||.||:||||.|..||.:||:.|:.
  Rat   176 SAVISFPPLISIEKKGAGGGQQPAE----PSCKINDQKWYVISSSIGSFFAPCLIMILVYVRIYQ 236

  Fly   295 ATRRRLRERARANKLNTIALKSTELEPMANSSPV--------------AASNSGSKSRLLASWLC 345
            ..:||.|            :..:...|.|.|:|.              .|..:|:::..|.:.|.
  Rat   237 IAKRRTR------------VPPSRRGPDACSAPPGGADRRPNGLGPERGAGTAGAEAEPLPTQLN 289

  Fly   346 CGRDRAQFATPMIQN--DQESISSETHQPQDSSKAGPHGNSDPQQQHVVVLVKKSRRAKTKDSIK 408
            ..........|...:  |.|..||..|..:      |.|...|:         :..|||      
  Rat   290 GAPGEPAPTRPRDGDALDLEESSSSEHAER------PQGPGKPE---------RGPRAK------ 333

  Fly   409 HGKTRGGRKSQSSSTCEPHGEQQLLPAGGDGGSCQPGGGHSGGGKSDAEISTESGSDPKGCIQVC 473
             |||:..:.....|          ||..|.|.:   |.|.||.|:.:........|..:|     
  Rat   334 -GKTKASQVKPGDS----------LPRRGPGAA---GPGASGSGQGEERAGGAKASRWRG----- 379

  Fly   474 VTQADEQTSLKLTPPQSSTGVAAVSVTPLQKKTSGVNQFIEEKQKISLSKERRAARTLGIIMGVF 538
                                                      :|    ::|:|....|.:::|||
  Rat   380 ------------------------------------------RQ----NREKRFTFVLAVVIGVF 398

  Fly   539 VICWLPFFLMYVILPFCQTCCPT-NKFKNFITWLGYINSGLNPVIYTIFNLDYRRAFKRLL 598
            |:||.|||..|.::   ...||. .:..||..|.||.||.||||||||||.|:|||||::|
  Rat   399 VVCWFPFFFTYTLI---AVGCPVPYQLFNFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKIL 456

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 65/131 (50%)
7tm_1 126..>293 CDD:278431 85/173 (49%)
Adra2aNP_036871.3 7tm_4 57..>185 CDD:304433 66/127 (52%)
7tm_1 65..441 CDD:278431 151/480 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D323202at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24248
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.