DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and Drd2

DIOPT Version :8

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_036679.1 Gene:Drd2 / 24318 RGDID:2520 Length:444 Species:Rattus norvegicus

Alignment Length:510 Identity:158/510 - (30%)
Similarity:246/510 - (48%) Gaps:129/510 - (25%)


  Fly   113 ALVLSVIIVLTIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVALLVLPFNVAYSILGRWEF 177
            |::|:::|.:.:.||:||.::|...|.|:...|:.|||||||||.||.||:|:.|...::|.|:|
  Rat    38 AMLLTLLIFIIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKF 102

  Fly   178 G-IHLCKLWLTCDVLCCTSSILNLCAIALDRYWAITDPI----NYAQKRTVGRVLLLISGVWLLS 237
            . || |.:::|.||:.||:||||||||::|||.|:..|:    .|:.||   ||.::|:.||:||
  Rat   103 SRIH-CDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKR---RVTVMIAIVWVLS 163

  Fly   238 LLISSPPLIGWNDWPDEFTSATPCELTSQRGYVIYSSLGSFFIPLAIMTIVYIEIFVATRRRLRE 302
            ..||.|.|.|.|:     |....| :.:...:|:|||:.||::|..:..:|||:|::..|:| |:
  Rat   164 FTISCPLLFGLNN-----TDQNEC-IIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKR-RK 221

  Fly   303 RA---------RANKLNTIALKSTELEPMANSSPVAASNSG---SKSRLLASWLCCGRDRAQFAT 355
            |.         |||....:....|..|.|...:.:..||..   ::.|:.|:      .|||   
  Rat   222 RVNTKRSSRAFRANLKTPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAA------RRAQ--- 277

  Fly   356 PMIQNDQESISSETHQPQDSSKAGPHGNSDPQQQHVVVLVKKSRRAKTKDSIKHGKTRGGRKSQS 420
               :.:.|.:||.:  |.:.::..|    .|...|.:.|...|..              |..|..
  Rat   278 ---ELEMEMLSSTS--PPERTRYSP----IPPSHHQLTLPDPSHH--------------GLHSNP 319

  Fly   421 SSTCEPHGEQQLLPAGGDGGSCQPGGGHSGGGKSDAEIST-------ESGSDPKGCIQVCVTQAD 478
            .|..:|.                 ..||       |:|..       |..:.|.|         .
  Rat   320 DSPAKPE-----------------KNGH-------AKIVNPRIAKFFEIQTMPNG---------K 351

  Fly   479 EQTSLKLTPPQSSTGVAAVSVTPLQKKTSGVNQFIEEKQKISLSKERRAARTLGIIMGVFVICWL 543
            .:||||..                            .::|:|..||::|.:.|.|::|||:||||
  Rat   352 TRTSLKTM----------------------------SRRKLSQQKEKKATQMLAIVLGVFIICWL 388

  Fly   544 PFFLMYVILPFCQTCCPTNKFKNFITWLGYINSGLNPVIYTIFNLDYRRAFKRLL 598
            |||:.:::...|....|...:..| |||||:||.:||:|||.||:::|:||.::|
  Rat   389 PFFITHILNIHCDCNIPPVLYSAF-TWLGYVNSAVNPIIYTTFNIEFRKAFMKIL 442

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 62/135 (46%)
7tm_1 126..>293 CDD:278431 75/171 (44%)
Drd2NP_036679.1 7tmA_D2_dopamine_R 35..438 CDD:320435 155/504 (31%)
TM helix 1 36..62 CDD:320435 8/23 (35%)
TM helix 2 69..92 CDD:320435 15/22 (68%)
TM helix 3 107..137 CDD:320435 18/29 (62%)
TM helix 4 152..170 CDD:320435 8/17 (47%)
TM helix 5 186..211 CDD:320435 9/24 (38%)
Agonist binding. {ECO:0000250} 190..197 4/6 (67%)
Interaction with PPP1R9B. {ECO:0000269|PubMed:10391935} 211..374 47/256 (18%)
TM helix 6 367..397 CDD:320435 15/29 (52%)
Agonist binding. {ECO:0000250} 387..395 5/7 (71%)
TM helix 7 406..431 CDD:320435 13/25 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000677
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.