DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and Adra2b

DIOPT Version :8

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_612514.2 Gene:Adra2b / 24174 RGDID:2057 Length:453 Species:Rattus norvegicus

Alignment Length:502 Identity:170/503 (34%)
Similarity:240/503 (48%) Gaps:89/503 (18%)


  Fly   112 TALVLSVI---IVLTIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVALLVLPFNVAYSILG 173
            ||.:.|.|   |:.||.||.||||:|.|.:.||..||.|:||||.||:.||.|::||::|..:||
  Rat    17 TAAIASAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELLG 81

  Fly   174 RWEFGIHLCKLWLTCDVLCCTSSILNLCAIALDRYWAITDPINYAQKRTVGRVLLLISGVWLLSL 238
            .|.|....|:::|..|||.|||||::||||:||||||::..:.|..|||..|:..:|..|||::.
  Rat    82 YWYFWRAWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCIILTVWLIAA 146

  Fly   239 LISSPPLIGWNDWPDEFTSATPCELTSQRGYVIYSSLGSFFIPLAIMTIVYIEIFVATRRRLRER 303
            :||.||||...|...|......|||..:..|::.||:||||.|..||.:||:.|:|..:|. ..|
  Rat   147 VISLPPLIYKGDQRPEPRGLPQCELNQEAWYILASSIGSFFAPCLIMILVYLRIYVIAKRS-HCR 210

  Fly   304 ARANKLNTIALKSTELEPMANSSPVAASNSGSKSRLLASWLCCGRDRAQFATPMIQNDQESISSE 368
            ....|..:...:|.:.:|:|...|.:|     |...|.|.|....:......|    .:|....|
  Rat   211 GLGAKRGSGEGESKKPQPVAGGVPTSA-----KVPTLVSPLSSVGEANGHPKP----PREKEEGE 266

  Fly   369 THQPQDSSKAGPHGNSDPQQQHVVVLVKKSRRAKTKDSIKHGKTRGGRKSQSSSTCEPHGEQ--- 430
            |.:..::....|..::.|:                       ..:|.:|..|.:|.|...|:   
  Rat   267 TPEDPEARALPPTWSALPR-----------------------SGQGQKKGTSGATAEEGDEEDEE 308

  Fly   431 -------QLLPAGGDGGSCQPGGGHSGGGKSDAEISTESGSDPKGCIQVCVTQADEQTSLKLTPP 488
                   |.||| .....|.|                                       .|..|
  Rat   309 EVEECEPQTLPA-SPASVCNP---------------------------------------PLQQP 333

  Fly   489 QSSTGVAAVSVTPLQKKTSGVNQFIEEKQKISLSKERRAARTLGIIMGVFVICWLPFFLMYVILP 553
            |:|..:|.:....|..|..||......:::..||:|:|....|.:::||||:||.|||..|.:..
  Rat   334 QTSRVLATLRGQVLLGKNVGVASGQWWRRRTQLSREKRFTFVLAVVIGVFVVCWFPFFFSYSLGA 398

  Fly   554 FCQTCC--PTNKFKNFITWLGYINSGLNPVIYTIFNLDYRRAFKRLL 598
            .|...|  |...|: |..|:||.||.|||||||:||.|:||||:|:|
  Rat   399 ICPQHCKVPHGLFQ-FFFWIGYCNSSLNPVIYTVFNQDFRRAFRRIL 444

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 67/134 (50%)
7tm_1 126..>293 CDD:278431 82/167 (49%)
Adra2bNP_612514.2 7tm_4 26..>157 CDD:304433 67/131 (51%)
7tm_1 34..429 CDD:278431 152/469 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D323202at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24248
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.