DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and ser-2

DIOPT Version :8

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001024339.1 Gene:ser-2 / 182110 WormBaseID:WBGene00004777 Length:455 Species:Caenorhabditis elegans

Alignment Length:566 Identity:192/567 (34%)
Similarity:289/567 (51%) Gaps:136/567 (24%)


  Fly    39 RGYTDSDDDAGMGTEAVANISGSLVEGLTTVTAALSTAQADKDSAGECEGAVEELHASILGLQ-- 101
            |.||||..:  |...|:.:|..|::    ..::|:||.            .:..|...:..::  
 Worm     3 RNYTDSVQE--MVLRAIDSIRDSVI----NASSAVSTT------------TLPPLDIPMTSMKPP 49

  Fly   102 LAVPEWEALLTALVLSVIIVLTIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVALLVLPFN 166
            ..:|..|.:|..:...|||.:|::||.||:::||:|:||:.|||:|:||||.:||.||:.|:|.:
 Worm    50 SIIPTVELVLGTITYLVIIAMTVVGNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLH 114

  Fly   167 VAYSIL-GRWEFGIHLCKLWLTCDVLCCTSSILNLCAIALDRYWAITDPINYAQKRTVGRVLLLI 230
            |...:. |:|..|:.:|:.:.|.|:|.|||||||||||||||||||.:|||||||||...|.::|
 Worm   115 VVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVI 179

  Fly   231 SGVWLLSLLISSPPLIGWNDWPDEFTSATPCELTSQRGYVIYSSLGSFFIPLAIMTIVYIEIFVA 295
            ..||:||:|||.||:||||:|.:.....: |.|::::.:|::|:.||||:||.:|.:||::||::
 Worm   180 VIVWILSMLISVPPIIGWNNWQENMMEDS-CGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFIS 243

  Fly   296 TRRRLRERARANKLNTIALKSTELEPMANSSPVAASNSGSKSRLLASWLCCGRDRAQFATPMIQN 360
            .|:|:|                                              .:|.:.|...|||
 Worm   244 ARQRIR----------------------------------------------TNRGRSALMRIQN 262

  Fly   361 DQESISSETHQPQDSSKAGPHGNSDPQQQHVVVLVKKSRRAKTKDSIKHGKTRGGRKSQSSSTCE 425
            .:                   |:.|.:                |.|||....      :|:.|..
 Worm   263 AE-------------------GDDDYR----------------KMSIKRASV------ESARTSS 286

  Fly   426 PHGEQQLLPAGGDGGSCQPGGGHSGGGKSDAEISTESGSDPKGCIQVCVTQADEQTS-LKLTPPQ 489
            ..||:..|.......:......|          ||:.||.||          ||.|. :|    .
 Worm   287 RVGEKTPLVIADGQTTVTTLAAH----------STDGGSLPK----------DETTKHMK----Y 327

  Fly   490 SSTGVAAVSVTPLQKKTSGVN--QFIEEKQKISLSKERRAARTLGIIMGVFVICWLPFFLMYVIL 552
            .:.|...|.|..:::.....|  ..:.:::|||::||:|||:|:.:|:.||..||||||:.|||.
 Worm   328 HNNGSCKVKVKDVKEDEGNPNPTAVLRKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIR 392

  Fly   553 PFCQTCCPTNKFKNFITWLGYINSGLNPVIYTIFNLDYRRAFKRLL 598
            |||:||....|.:...||||||||.|||.:|.|.||::|||||::|
 Worm   393 PFCETCKLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKIL 438

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 73/132 (55%)
7tm_1 126..>293 CDD:278431 89/168 (53%)
ser-2NP_001024339.1 7tm_1 74..423 CDD:278431 162/461 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1748480
eggNOG 1 0.900 E33208_3BCYC
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 333 1.000 Inparanoid score I1403
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D323202at33208
OrthoFinder 1 1.000 FOG0000677
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133249
Panther 1 1.100 LDO PTHR24248
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.