DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and DRD3

DIOPT Version :8

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_000787.2 Gene:DRD3 / 1814 HGNCID:3024 Length:400 Species:Homo sapiens

Alignment Length:496 Identity:147/496 - (29%)
Similarity:223/496 - (44%) Gaps:140/496 - (28%)


  Fly   113 ALVLSVIIVLTIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVALLVLPFNVAYSILGR-WE 176
            ||....:|:..:.||.||.::|...:.|:...|:.:||||||||.||.||:|:.|...:.|. |.
Human    33 ALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWN 97

  Fly   177 FGIHLCKLWLTCDVLCCTSSILNLCAIALDRYWAITDPINYAQ---KRTVGRVLLLISGVWLLSL 238
            |....|.:::|.||:.||:||||||||::|||.|:..|::|..   :.:..||.|:|:.||:|:.
Human    98 FSRICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAF 162

  Fly   239 LISSPPLIGWNDWPDEFTSATPCELTSQRGYVIYSSLGSFFIPLAIMTIVYIEIFVATRRRLRER 303
            .:|.|.|.|:|...|    .|.|.: |...:|||||:.||::|..:..:||..|:|..::|.|:|
Human   163 AVSCPLLFGFNTTGD----PTVCSI-SNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKR 222

  Fly   304 ARANKLNTIALKSTELEPMANSSPVAASNSGSKSRLLASWLCCGRDRAQFATPMIQNDQESISSE 368
            ....:               ||.                   |...|..|....:..|...:..:
Human   223 ILTRQ---------------NSQ-------------------CNSVRPGFPQQTLSPDPAHLELK 253

  Fly   369 THQP--QDSSKAGP----HGNSDPQQQHVVVLVKKSRRAKTKDSIKHGKTRGGRKSQSSSTCEPH 427
            .:..  ||::..||    .|.            :..|..||::|:             |.|..| 
Human   254 RYYSICQDTALGGPGFQERGG------------ELKREEKTRNSL-------------SPTIAP- 292

  Fly   428 GEQQLLPAGGDGGSCQPGGGHSGGGKSDAEISTESGSDPKGCIQVCVTQADEQTSLKLTPPQSST 492
                                         ::|.|......|.:         .|||||.|.| ..
Human   293 -----------------------------KLSLEVRKLSNGRL---------STSLKLGPLQ-PR 318

  Fly   493 GVAAVSVTPLQKKTSGVNQFIEEKQKISLSKERRAARTLGIIMGVFVICWLPFFLMYVILPFCQT 557
            ||      ||                    :|::|.:.:.|::|.|::|||||||.:|:...|||
Human   319 GV------PL--------------------REKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQT 357

  Fly   558 CCPTNKFKNFITWLGYINSGLNPVIYTIFNLDYRRAFKRLL 598
            |..:.:..:..|||||:||.|||||||.||:::|:||.::|
Human   358 CHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKIL 398

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 55/134 (41%)
7tm_1 126..>293 CDD:278431 70/170 (41%)
DRD3NP_000787.2 7tm_4 44..>216 CDD:304433 72/176 (41%)
7tm_1 46..383 CDD:278431 135/466 (29%)
Agonist binding 189..196 5/6 (83%)
Agonist binding 342..350 6/7 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000677
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.