DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and Htr1a

DIOPT Version :8

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_032334.2 Gene:Htr1a / 15550 MGIID:96273 Length:421 Species:Mus musculus

Alignment Length:494 Identity:158/494 - (31%)
Similarity:237/494 - (47%) Gaps:120/494 - (24%)


  Fly   110 LLTALVLSVIIVLTIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVALLVLPFNVAYSILGR 174
            ::|:|:|..:|...::||..|:.::...:.|:.|.|:.|.||||.||.|::||||....|.:|.:
Mouse    37 VITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNK 101

  Fly   175 WEFGIHLCKLWLTCDVLCCTSSILNLCAIALDRYWAITDPINYAQKRTVGRVLLLISGVWLLSLL 239
            |..|...|.|::..||||||||||:||||||||||||||||:|..|||..|...|||..||:..|
Mouse   102 WTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFL 166

  Fly   240 ISSPPLIGWNDWPDEFTSATPCELTSQRGYVIYSSLGSFFIPLAIMTIVYIEIFVATRRRLRERA 304
            ||.||::||.. |::.::...|.::...||.|||:.|:|:|||.:|.::|..||.|.|.|:|:..
Mouse   167 ISIPPMLGWRT-PEDRSNPNECTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTV 230

  Fly   305 RANKLNTIALKSTELEPMANSSPVAASNSGSKSRLLASWLCCGRDRAQFATPMIQNDQESISSET 369
            :                     .|....:|:                            |..:.:
Mouse   231 K---------------------KVEKKGAGT----------------------------SFGTSS 246

  Fly   370 HQPQDSSKAGPHGNSDPQQQHVVVLVKKSRRAKTKDSI----KHGKTRGGRKSQSSSTCEPHGEQ 430
            ..|...|..|..|:.|            .||:....::    .:|..|.|....:....|.|   
Mouse   247 APPPKKSLNGQPGSGD------------CRRSAENRAVGTPCANGAVRQGEDDATLEVIEVH--- 296

  Fly   431 QLLPAGGDGGSCQPGGGHSGGGKSDAEISTESGSDPKGCIQVCVTQADEQTSLKLTPPQSSTGVA 495
                             ..|..|....:.:|||:  ...:..|:.:.:|:|:             
Mouse   297 -----------------RVGNSKGHLPLPSESGA--TSYVPACLERKNERTA------------- 329

  Fly   496 AVSVTPLQKKTSGVNQFIEEKQKISLSKERRAARTLGIIMGVFVICWLPFFLMYVILPFCQTCCP 560
                              |.|:|::|::||:..:|||||||.|::||||||::.::||||::.|.
Mouse   330 ------------------EAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCH 376

  Fly   561 TNKFKN-FITWLGYINSGLNPVIYTIFNLDYRRAFKRLL 598
            ..:... .|.||||.||.||||||..||.|::.|||:::
Mouse   377 MPELLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKII 415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 66/130 (51%)
7tm_1 126..>293 CDD:278431 81/166 (49%)
Htr1aNP_032334.2 7tm_4 48..>169 CDD:304433 62/120 (52%)
7tm_1 53..400 CDD:278431 146/461 (32%)
Agonist binding. {ECO:0000250} 112..121 4/8 (50%)
DRY motif, important for ligand-induced conformation changes. {ECO:0000250} 133..135 1/1 (100%)
Agonist binding. {ECO:0000250} 358..362 3/3 (100%)
NPxxY motif, important for ligand-induced conformation changes and signaling. {ECO:0000250} 396..400 3/3 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BCYC
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133249
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.