DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and ADRA2C

DIOPT Version :8

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_000674.2 Gene:ADRA2C / 152 HGNCID:283 Length:462 Species:Homo sapiens

Alignment Length:591 Identity:184/591 - (31%)
Similarity:270/591 - (45%) Gaps:155/591 - (26%)


  Fly    18 AAALTAAAAVSTTKSGSGNAARGYTDSDDDAGMGTEAVANISGSLVEGLTTVTAALSTAQADKDS 82
            ||||..|||.....||:|.             .|:..|||.||:                    |
Human     7 AAALAVAAAAGPNASGAGE-------------RGSGGVANASGA--------------------S 38

  Fly    83 AGECEGAVEELHASILGLQLAVPEWEALLTALVLSVIIVLTIIGNILVILSVFTYKPLRIVQNFF 147
            .|...|....  .::.||            |.|:..:||.|::||:||:::|.|.:.||..||.|
Human    39 WGPPRGQYSA--GAVAGL------------AAVVGFLIVFTVVGNVLVVIAVLTSRALRAPQNLF 89

  Fly   148 IVSLAVADLTVALLVLPFNVAYSILGRWEFGIHLCKLWLTCDVLCCTSSILNLCAIALDRYWAIT 212
            :||||.||:.||.||:||::|..::..|.||...|.::|..|||.|||||::||||:|||||::|
Human    90 LVSLASADILVATLVMPFSLANELMAYWYFGQVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVT 154

  Fly   213 DPINYAQKRTVGRVLLLISGVWLLSLLISSPPLIGWNDWPDEFTSATP-CELTSQRGYVIYSSLG 276
            ..:.|..|||..||...|..|||:|.:||.|||:.....||  .:|.| |.|..:..|::.|.:|
Human   155 QAVEYNLKRTPRRVKATIVAVWLISAVISFPPLVSLYRQPD--GAAYPQCGLNDETWYILSSCIG 217

  Fly   277 SFFIPLAIMTIVYIEIFVATRRRLRERARANKLNTIALKSTELEPMANSSPV------AASNSGS 335
            |||.|..||.:||..|:...:.|.|         |::.|...:.| ..:||.      ||:.:|.
Human   218 SFFAPCLIMGLVYARIYRVAKLRTR---------TLSEKRAPVGP-DGASPTTENGLGAAAGAGE 272

  Fly   336 KSRLLASWLCCGRDRAQFATPMIQNDQESISSETHQPQDSSKAGPHGNSDPQQQHVVVLVKKSRR 400
            ...       |....|.     ::.|:.|.::|                           ::.||
Human   273 NGH-------CAPPPAD-----VEPDESSAAAE---------------------------RRRRR 298

  Fly   401 AKTKDSIKHGKTRGGRKSQSSSTCEPHGEQQLLPAGGDGGSCQPGGGHSGGGKSDAEISTESGS- 464
            ...:        ||||:.                ||.:||:....|..:|.|.:::...|.|.| 
Human   299 GALR--------RGGRRR----------------AGAEGGAGGADGQGAGPGAAESGALTASRSP 339

  Fly   465 DPKGCIQVCVTQADEQTSLKLTPPQSSTGVAAVSVTPLQKKTSGVNQFIEEKQKISLSKERRAAR 529
            .|.|.:.                 ::|:......::..::..|.|.     ::|::.::|:|...
Human   340 GPGGRLS-----------------RASSRSVEFFLSRRRRARSSVC-----RRKVAQAREKRFTF 382

  Fly   530 TLGIIMGVFVICWLPFFLMYVILPFCQTCC--PTNKFKNFITWLGYINSGLNPVIYTIFNLDYRR 592
            .|.::|||||:||.|||..|.:...|:..|  |...|| |..|:||.||.|||||||:||.|:||
Human   383 VLAVVMGVFVLCWFPFFFSYSLYGICREACQVPGPLFK-FFFWIGYCNSSLNPVIYTVFNQDFRR 446

  Fly   593 AFKRLL 598
            :||.:|
Human   447 SFKHIL 452

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 65/130 (50%)
7tm_1 126..>293 CDD:278431 80/167 (48%)
ADRA2CNP_000674.2 7tm_4 60..>184 CDD:304433 62/123 (50%)
7tm_1 68..437 CDD:278431 147/466 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D323202at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24248
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.