DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and htr1d

DIOPT Version :8

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_002938881.2 Gene:htr1d / 100494760 XenbaseID:XB-GENE-992184 Length:352 Species:Xenopus tropicalis

Alignment Length:509 Identity:144/509 - (28%)
Similarity:229/509 - (44%) Gaps:168/509 - (33%)


  Fly    95 ASILGLQLAVPEWEALLTALVLSVIIVLTIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVA 159
            :::|||::.:        |::||:|.:.|::.|:.||:::...:.|....|:.|.|||..||.|:
 Frog     7 STLLGLKITL--------AVLLSIITLATLLSNVFVIITIVMTRKLHTPANYLIGSLAFTDLLVS 63

  Fly   160 LLVLPFNVAYSILGRWEFGIHLCKLWLTCDVLCCTSSILNLCAIALDRYWAITDPINYAQKRTVG 224
            :||:|.::||::...|.||..:|.:||..|:.|||:|||:||.|||||||||||.:.|.:.||..
 Frog    64 ILVMPISIAYTVTHTWTFGQIVCDIWLLSDITCCTASILHLCVIALDRYWAITDALEYTKHRTAR 128

  Fly   225 RVLLLISGVWLLSLLISSPPLIGWNDWPDEFTSATPCEL-TSQRGYVIYSSLGSFFIPLAIMTIV 288
            |..::|..||::|:.||.|||. |.. .......|.|.: |.|..|.|||:.|:|:||..::.::
 Frog   129 RAAVMILVVWIISICISIPPLF-WRQ-AKAHEELTVCTINTDQISYTIYSTCGAFYIPTVLLILL 191

  Fly   289 YIEIFVATRRRLRERARANKLNTIALKSTELEPMANSSPVAASNSGSKSRLLASWLCCGRDRAQF 353
            |.:|::|.|.|:                  |:|        .|..|  .|...:.|..|...:.|
 Frog   192 YGKIYIAARSRI------------------LKP--------PSIYG--KRFTTAQLIPGSTGSSF 228

  Fly   354 ATPMIQNDQESISSETHQPQDSSKAGPHGNSDPQQQHVVVLVKKSRRAKTKDSIKHGKTRGGRKS 418
            .         ||::..|...      ||.:..|                                
 Frog   229 C---------SINANVHMEH------PHTSETP-------------------------------- 246

  Fly   419 QSSSTCEPHGEQQLLPAGGDGGSCQPGGGHSGGGKSDAEISTESGSDPKGCIQVCVTQADEQTSL 483
                                                                 ||:    ....:
 Frog   247 -----------------------------------------------------VCI----NHIKI 254

  Fly   484 KLTPPQSSTGVAAVSVTPLQKKTSGVNQFIEEKQKISLSKERRAARTLGIIMGVFVICWLPFFLM 548
            ||.                        ..|.|::::|.::|::|.:|||||:|.|::||||||::
 Frog   255 KLA------------------------DSIIERKRLSAAREKKATKTLGIILGAFIVCWLPFFVV 295

  Fly   549 YVILPFCQTCCPTNKFK-NFITWLGYINSGLNPVIYTIFNLDYRRAFKRLLGLN 601
            .::||.|:..|..:... :|.|||||:||.:||||||:||.|:::||::|:.||
 Frog   296 SLVLPICRDACWFDPLLFDFFTWLGYLNSLINPVIYTVFNEDFKKAFQKLIRLN 349

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 58/130 (45%)
7tm_1 126..>293 CDD:278431 70/167 (42%)
htr1dXP_002938881.2 7tm_1 31..331 CDD:278431 125/457 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H20240
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.