DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and drd2

DIOPT Version :8

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_017951537.1 Gene:drd2 / 100493063 XenbaseID:XB-GENE-1005779 Length:442 Species:Xenopus tropicalis

Alignment Length:505 Identity:163/506 (32%)
Similarity:243/506 (48%) Gaps:115/506 (23%)


  Fly   113 ALVLSVIIVLTIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVALLVLPFNVAYSILGRWEF 177
            |::|:::|.:.:.||:||.::|...|.|:...|:.|||||||||.||.||:|:.|...::|.|.|
 Frog    32 AMLLTLLIFVIVFGNVLVCIAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYMEVVGEWRF 96

  Fly   178 G-IHLCKLWLTCDVLCCTSSILNLCAIALDRYWAITDPI----NYAQKRTVGRVLLLISGVWLLS 237
            . || |.:::|.||:.||:||||||||::|||.|:..|:    .|:.||   ||.::||.||:||
 Frog    97 SRIH-CDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKR---RVTVMISVVWVLS 157

  Fly   238 LLISSPPLIGWNDWPDEFTSATPCELTSQRGYVIYSSLGSFFIPLAIMTIVYIEIFVATRRRLRE 302
            ..||.|.|.|.|:     |::..| :.....:|||||:.||::|..:..:||::|::..|:|   
 Frog   158 FAISCPLLFGLNN-----TASKVC-IIDNPAFVIYSSIVSFYVPFIVTLLVYVQIYIVLRKR--- 213

  Fly   303 RARAN--------KLNTIALKSTELEPMANSSPVAASNSGSKSRLLASWLCCGRDRAQFATPMIQ 359
            |.|.|        ::|....|.|..|.:.                    ||     |.|      
 Frog   214 RKRVNTKRNSHGVEVNAHKDKCTHPEDVK--------------------LC-----AVF------ 247

  Fly   360 NDQESISSETHQPQDSSK------AGPHGNSDPQQQHVVVLVKKSRRAKTKDSIKHGKTRGGRKS 418
                 :.|....|.|..|      ||.|    |:...|.::...|...|||           .||
 Frog   248 -----VKSNGSFPTDKKKVILVQEAGNH----PEDMDVEMMSSTSPPEKTK-----------HKS 292

  Fly   419 QSSSTCEPHGEQQLLPAGGDGGSCQPGGGHSGGGKSDAEISTESGSDPKGCIQVCVTQADEQTSL 483
            .|     |:..|..:||  ....|......|   ..|:....|....||..              
 Frog   293 AS-----PNHHQLAVPA--TSNQCNNANLPS---PVDSPYKAEKNGHPKDS-------------- 333

  Fly   484 KLTPPQSSTGVAAVSVTPLQKKTSGVNQFIEEKQKISLSKERRAARTLGIIMGVFVICWLPFFLM 548
              |.|..   |..:...|..|..:.:...  .|:|:|..||::|.:.|.|::|||:|||||||::
 Frog   334 --TKPAK---VFEIQTMPNGKTRTSIKTM--SKRKLSQHKEKKATQMLAIVLGVFIICWLPFFII 391

  Fly   549 YVILPFCQTCCPTNKFKNFITWLGYINSGLNPVIYTIFNLDYRRAFKRLL 598
            :::...|....|...:..| |||||:||.:||:|||.||:::|:||.::|
 Frog   392 HILNMHCNCNIPQALYSAF-TWLGYVNSAVNPIIYTTFNVEFRKAFIKIL 440

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 64/136 (47%)
7tm_1 126..>293 CDD:278431 77/172 (45%)
drd2XP_017951537.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000677
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.