DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and adra2b

DIOPT Version :8

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_002932610.1 Gene:adra2b / 100485811 XenbaseID:XB-GENE-999343 Length:410 Species:Xenopus tropicalis

Alignment Length:495 Identity:161/495 - (32%)
Similarity:239/495 - (48%) Gaps:118/495 - (23%)


  Fly   113 ALVLSVIIVLTIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVALLVLPFNVAYSILGRWEF 177
            |.:::.:::.||.||:|||::|.|.:.|:..||.|:||||.||:.||.|::||::|..::|.|.|
 Frog    16 AAIITFLVLFTIFGNVLVIIAVLTSRSLKAPQNLFLVSLAAADILVATLIIPFSLANELMGYWYF 80

  Fly   178 GIHLCKLWLTCDVLCCTSSILNLCAIALDRYWAITDPINYAQKRTVGRVLLLISGVWLLSLLISS 242
            |...|:::|..|||.|||||::||||:|||||:::..|.|..|||..|:..:|..||.|:.|||.
 Frog    81 GKTWCEMYLALDVLFCTSSIVHLCAISLDRYWSVSQAIEYNSKRTPKRIKCIILIVWTLAALISL 145

  Fly   243 PPLIGWNDWPDEFTSATP-CELTSQRGYVIYSSLGSFFIPLAIMTIVYIEIFVATRRRLRERARA 306
            ||||......|:  :|.| |:|..:..|::.||:.|||.|..||.:||:.|::..:||.|:.:..
 Frog   146 PPLIYKGKSKDQ--NAKPECKLNEEPWYILSSSICSFFAPCLIMILVYLRIYLIAKRRNRKNSTD 208

  Fly   307 NKLNTIA--LKSTELEPMANSSPVAAS----NSGSKSRLLASWLCCGRDRAQFATPMIQNDQESI 365
            .||..:|  |.|...:...|||.....    :|..|:.|....|.||       .|::.:.:|  
 Frog   209 KKLKKMAPGLFSRTNKHSLNSSHTQTQCGIISSQEKTGLALDDLHCG-------VPVLSSTRE-- 264

  Fly   366 SSETHQPQDSSKAGPHGNSDPQQQHVVVLVKKSRRAKTKDSIKHGKTRGGRKSQSSSTCEPHGEQ 430
              |.:...:|....|.|                      :::||  |.|         |||    
 Frog   265 --ERNGHSESFGLQPQG----------------------ENLKH--TNG---------CEP---- 290

  Fly   431 QLLPAGGDGGSCQPGGGHSGGGKSDAEISTESGSDPKGCIQVCVTQADEQTSLKLTPPQSSTGVA 495
                                     |.:.|                                 ||
 Frog   291 -------------------------AVMDT---------------------------------VA 297

  Fly   496 AVSVTPLQKKTSGVNQFIEEKQKISLSKERRAARTLGIIMGVFVICWLPFFLMYVILPFCQTCC- 559
            .|....|..|.:..:.....|:|..:::|:|....|.:::||||:||.|||..|.:...|...| 
 Frog   298 TVKGVMLMPKGAKDSDLSSAKKKSYINREKRFTFVLAVVIGVFVLCWFPFFFTYSLGAICTELCY 362

  Fly   560 -PTNKFKNFITWLGYINSGLNPVIYTIFNLDYRRAFKRLL 598
             |.:.|: |..|:||.||.||||||||||.|:|:||:|:|
 Frog   363 IPDSVFQ-FFFWIGYCNSSLNPVIYTIFNQDFRKAFRRIL 401

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 62/130 (48%)
7tm_1 126..>293 CDD:278431 79/167 (47%)
adra2bXP_002932610.1 7tm_4 20..>152 CDD:304433 65/131 (50%)
7tm_1 29..386 CDD:278431 146/465 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D323202at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.