DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and LOC100330650

DIOPT Version :8

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_002663705.3 Gene:LOC100330650 / 100330650 -ID:- Length:431 Species:Danio rerio

Alignment Length:501 Identity:161/502 (32%)
Similarity:239/502 (48%) Gaps:100/502 (20%)


  Fly   105 PEWEALLTALVLSVIIVLTIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVALLVLPFNVAY 169
            ||..|:. |:.:::|::.||.|||:||::|.|.:.||..||.|:||||.||:.||.||:||::|.
Zfish    15 PEITAVF-AITMTLIMLFTIFGNIMVIIAVLTCRSLRGPQNLFLVSLAAADILVATLVIPFSLAK 78

  Fly   170 SILGRWEFGIHLCKLWLTCDVLCCTSSILNLCAIALDRYWAITDPINYAQKRTVGRVLLLISGVW 234
            .::|.|.|....|::.|..|||.|||||::||||:||||.:|:.|:.|..:||..::...|..||
Zfish    79 ELMGCWYFESLWCEIILALDVLFCTSSIIHLCAISLDRYLSISRPVQYGTQRTPRKIKGAIVVVW 143

  Fly   235 LLSLLISSPPLIGWNDWPDEFTS--ATPCELTSQRGYVIYSSLGSFFIPLAIMTIVYIEIFVATR 297
            |:|.:||.|||:.. |.|.:...  .|.|||...:.|::||::||||.|..||.:||:.|:    
Zfish   144 LISAIISFPPLVSM-DKPQQAKGDPRTTCELNEDKWYILYSTIGSFFAPCLIMILVYVRIY---- 203

  Fly   298 RRLRERARANKLNTIALKSTEL---EPMANSSPVAASNSGSKSRLLASWLCCGRDRAQFATPMIQ 359
                         .||.|.|..   ||..:|:                   .||:        :|
Zfish   204 -------------QIAKKHTRCPPGEPRKDSA-------------------VGRE--------LQ 228

  Fly   360 NDQESISSETHQPQDSSKAGPHGNSDPQQQHVVVLVKKSRRAKTKDSIKHGKTRGGRKSQSSSTC 424
            |.::......:.|.                   :...||...|....|    |...:|::.|..|
Zfish   229 NGKDGGVDSANNPN-------------------IAPSKSEAVKQPPVI----TESAQKTKRSRRC 270

  Fly   425 EPHGEQQLLPAGGDGGSCQPGGGHSGGGKSDAEISTESGSDPKGCIQVCVTQADEQTSLKLTPPQ 489
            :.:.|:    :...|...:..|||...|       |.|...|...:.....|:....::..|...
Zfish   271 KENKEE----SSSSGSDVEVVGGHDANG-------TNSNMAPLETVNKTPAQSQSYRNIIATSKG 324

  Fly   490 SSTGVAAVSVTPLQKKTSGVNQFIEEKQKISLSKERRAARTLGIIMGVFVICWLPFFLMYVILPF 554
            |....|..:.||            ..::|..:.:|:|....|.:::|||:|||.|||..|.:...
Zfish   325 SQLANAKATGTP------------NTRRKAMIVREKRFTFVLAVVIGVFIICWFPFFFSYSLQAI 377

  Fly   555 CQTCC--PTNKFKNFITWLGYINSGLNPVIYTIFNLDYRRAFKRLL 598
            |...|  |...| .|..|:||.||.|||:||||||.|:|:|||::|
Zfish   378 CPDMCKVPEGLF-TFFFWIGYCNSALNPLIYTIFNRDFRKAFKKIL 422

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 63/131 (48%)
7tm_1 126..>293 CDD:278431 80/169 (47%)
LOC100330650XP_002663705.3 7tm_4 26..>151 CDD:304433 61/125 (49%)
7tm_1 35..407 CDD:278431 143/464 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D323202at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T596395
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24248
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.