DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EloB and Elob

DIOPT Version :8

Sequence 1:NP_524416.1 Gene:EloB / 42435 FlyBaseID:FBgn0023212 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_080581.1 Gene:Elob / 67673 MGIID:1914923 Length:118 Species:Mus musculus

Alignment Length:118 Identity:65/118 - (55%)
Similarity:87/118 - (73%) Gaps:2/118 - (1%)


  Fly     1 MDVFLMIRRQKTTIFTDAKENTTVAELKRMIEGILKVQPVDQRLYNQDNDVMEDDSTLQDYGVTV 65
            |||||||||.||||||||||::||.||||::|||||..|.:|||| :|:.:::|..||.:.|.|.
Mouse     1 MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPEEQRLY-KDDQLLDDGKTLGECGFTS 64

  Fly    66 STAKAQAPAQLGLTFRNEVGDFETLDMTPYSAPPDLPEVMKNQEASNGQEQVA 118
            .||:.||||.:||.||.: ..||.|.:.|:|:||:||:|||.|::.....:.|
Mouse    65 QTARPQAPATVGLAFRAD-DTFEALRIEPFSSPPELPDVMKPQDSGGSANEQA 116

Known Domains:


GeneSequenceDomainRegion External IDIdentity
EloBNP_524416.1 UBQ 1..116 CDD:294102 64/114 (56%)
ElobNP_080581.1 Ubl_ElonginB 2..102 CDD:340486 59/101 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C359763561
eggNOG 1 0.900 E1_KOG4495
Hieranoid 1 1.000
Homologene 1 1.000 H136219
Inparanoid 1 1.050 125 1.000 Inparanoid score I4643
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004377
OrthoInspector 1 1.000 T615507
orthoMCL 1 0.900 OOG5_133606
Panther 1 1.100 LDO PTHR13248
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3160
TreeFam 1 0.960
1211.880

Return to query results.
Submit another query.