DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EloB and LOC569097

DIOPT Version :8

Sequence 1:NP_524416.1 Gene:EloB / 42435 FlyBaseID:FBgn0023212 Length:118 Species:Drosophila melanogaster
Sequence 2:XP_001924016.1 Gene:LOC569097 / 569097 ID: Length:420 Species:Danio rerio

Alignment Length:49 Identity:14/49 - (28%)
Similarity:20/49 - (40%) Gaps:6/49 - (12%)


  Fly    27 LKRMIEGILKVQPVDQRLYNQDNDVMEDDSTLQDYGVTVSTAKAQAPAQ 75
            |.|.:|.:::...|.| :..|.|...:.||..|     ..|.|...|.|
Zfish    35 LDRAVEEMIEADLVAQ-VQEQINSAQQKDSADQ-----TQTPKQSEPKQ 77

Known Domains:


GeneSequenceDomainRegion External IDIdentity
EloBNP_524416.1 UBQ 1..116 CDD:294102 14/49 (29%)
LOC569097XP_001924016.1 DDE_Tnp_4 249..370 CDD:328798
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C359768338
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.