powered by:
Protein Alignment EloB and LOC569097
DIOPT Version :8
Sequence 1: | NP_524416.1 |
Gene: | EloB / 42435 |
FlyBaseID: | FBgn0023212 |
Length: | 118 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001924016.1 |
Gene: | LOC569097 / 569097 |
ID: | |
Length: | 420 |
Species: | Danio rerio |
Alignment Length: | 49 |
Identity: | 14/49 - (28%) |
Similarity: | 20/49 - (40%) |
Gaps: | 6/49 - (12%) |
Fly 27 LKRMIEGILKVQPVDQRLYNQDNDVMEDDSTLQDYGVTVSTAKAQAPAQ 75
|.|.:|.:::...|.| :..|.|...:.||..| ..|.|...|.|
Zfish 35 LDRAVEEMIEADLVAQ-VQEQINSAQQKDSADQ-----TQTPKQSEPKQ 77
|
Known Domains:
Gene | Sequence | Domain | Region |
External ID | Identity |
EloB | NP_524416.1 |
UBQ |
1..116 |
CDD:294102 |
14/49 (29%) |
LOC569097 | XP_001924016.1 |
DDE_Tnp_4 |
249..370 |
CDD:328798 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
|
|
|
C359768338 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
1 |
1.010 |
|
|
|
|
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.940 |
|
Return to query results.
Submit another query.