DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4360 and BCL11A

Sequence 1:NP_650879.1 Gene:CG4360 FlyBaseID:FBgn0038787 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_075044.2 Gene:BCL11A HGNCID:13221 Length:835 Species:Homo sapiens

Alignment Length:557 Identity:119/558 (21%)
Similarity:190/558 (34%) Gaps:164/558 (29%)


  Fly    84 QAMLHPQHPLVHLLDISTTTANSGGGGGGSHTPI--SPMKQEVQSVISEEEVVVDDPRKKKQCHV 146
            |.:|.|..|                   ||..|.  :|....:||.....:    .|.|.|.|..
Human   340 QRLLQPFQP-------------------GSKPPFLATPPLPPLQSAPPPSQ----PPVKSKSCEF 381

  Fly   147 CKNKFRQLTTLRNHMKIHTDERPYKCKHCDKAFRQISTLTNHVKIH------------------T 193
            |...|:..:.|..|.:.||.|:||||..||.|..|.|.|..|:|.|                  :
Human   382 CGKTFKFQSNLVVHRRSHTGEKPYKCNLCDHACTQASKLKRHMKTHMHKSSPMTVKSDDGLSTAS 446

  Fly   194 GEKPFTCNICAKDFRQQSTLINHIKTHKAAESSTPTSLLNYQPQTGSGKHRKSQMHQAYQQQHQR 258
            ..:|.|.::.........:::...|:     .:.|    |..|:.|..:..:....:..:::.:.
Human   447 SPEPGTSDLVGSASSALKSVVAKFKS-----ENDP----NLIPENGDEEEEEDDEEEEEEEEEEE 502

  Fly   259 VQISKTL---YSGSYSSPAAEELVKPFQCSVC-----KRRFPQ------LSTLHN---------- 299
            .:::::.   |....|..||.......:.:|.     .|..|.      ||::.:          
Human   503 EELTESERVDYGFGLSLEAARHHENSSRGAVVGVGDESRALPDVMQGMVLSSMQHFSEAFHQVLG 567

  Fly   300 --HERTHIDPKPYKCETCDKSFSQLATLANHKKIHTGDKPYTCSYCHMQFRQQSTLTNHLKTHTH 362
              |:|.|:.......:|||:                                     :.:...:.
Human   568 EKHKRGHLAEAEGHRDTCDE-------------------------------------DSVAGESD 595

  Fly   363 QIAPGGVGGAG-----GGGGAVTATVDHSMPAPLAPGTQQ--------LTSGLLPNN-------L 407
            :|..|.|.|.|     ...|.::..:....|:.|:|.:::        |....:||.       |
Human   596 RIDDGTVNGRGCSPGESASGGLSKKLLLGSPSSLSPFSKRIKLEKEFDLPPAAMPNTENVYSQWL 660

  Fly   408 HGSTANIIQLDHHPLLHFLD-------GSTTVSSVVATAAANTKVEHFQAG-----GSPSGRMTV 460
            .|..|:....|  |.|.|.|       .|:..||...:...:|.......|     |:.||    
Human   661 AGYAASRQLKD--PFLSFGDSRQSPFASSSEHSSENGSLRFSTPPGELDGGISGRSGTGSG---- 719

  Fly   461 VGTINMLKGDNPDRPFG--------CSVCQRFFSQQSTLVNHIKTHTGEKPYKCKICEVNFRQVA 517
             |:...:.|..|.||..        |..|.:.|...|.|..|.::||||:||||::|.....|.:
Human   720 -GSTPHISGPGPGRPSSKEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSS 783

  Fly   518 TLNNHMKIH--TGEKPYNCSFCPKQFRQKSTLQNHLR 552
            .|..|||.|  .|:..|.|..|...|...|||:.|::
Human   784 KLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMK 820

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4360NP_650879.1 C2H2 Zn finger 144..164 CDD:275368 5/20 (25%)
zf-H2C2_2 157..181 CDD:290200 12/24 (50%)
C2H2 Zn finger 172..192 CDD:275368 9/20 (45%)
zf-H2C2_2 185..209 CDD:290200 6/42 (14%)
C2H2 Zn finger 200..220 CDD:275368 1/20 (5%)
C2H2 Zn finger 284..304 CDD:275368 7/43 (16%)
zf-C2H2_8 287..363 CDD:292531 10/99 (10%)
C2H2 Zn finger 312..332 CDD:275368 3/20 (15%)
C2H2 Zn finger 340..360 CDD:275368 0/20 (0%)
C2H2 Zn finger 478..498 CDD:275368 6/20 (30%)
zf-H2C2_2 491..515 CDD:290200 11/24 (46%)
C2H2 Zn finger 506..526 CDD:275368 7/20 (35%)
zf-H2C2_2 519..543 CDD:290200 10/26 (38%)
C2H2 Zn finger 534..554 CDD:275368 7/20 (35%)
BCL11ANP_075044.2 Required for nuclear body formation and for SUMO1 recruitment. {ECO:0000250} 1..210
C2H2 Zn finger 379..399 CDD:275368 5/20 (25%)
zf-H2C2_2 391..416 CDD:316026 12/25 (48%)
C2H2 Zn finger 407..427 CDD:275368 9/20 (45%)
zf-C2H2 743..764 CDD:306579 6/21 (29%)
C2H2 Zn finger 744..764 CDD:275368 6/20 (30%)
zf-H2C2_2 756..781 CDD:316026 11/25 (44%)
C2H2 Zn finger 772..792 CDD:275368 7/20 (35%)
C2H2 Zn finger 802..820 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.