DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4360 and wdn

Sequence 1:NP_650879.1 Gene:CG4360 FlyBaseID:FBgn0038787 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_476900.1 Gene:wdn FlyBaseID:FBgn0005642 Length:869 Species:Drosophila melanogaster

Alignment Length:532 Identity:108/533 (20%)
Similarity:162/533 (30%) Gaps:200/533 (38%)


  Fly    50 NSGQQQPTTLASLQQSPFALHQ-----------------LTAVQAI------------QHPTHQA 85
            :||...|..|     ||..|||                 |.|..|:            :||..|.
  Fly   157 SSGTSTPVKL-----SPEQLHQQHQLQMPQSQLLQRKPKLPAATAVRLKVFKEEPPEEKHPPEQV 216

  Fly    86 ----------MLHPQHPLVHLLDISTTTANSGGGGGGSHTPISPMK----------------QEV 124
                      :|.|...:......:.:.|::......:.:...|::                .|.
  Fly   217 VTKVEVCESELLPPSFTIFQQAKSAESVADAASMPPPAASETKPLEVDPAPLHKCLDCNGLLLET 281

  Fly   125 QSVISEEEVVVDDPRKKKQCHVCKNKFRQLTTLRNHM---------------------------- 161
            ...:::.|......|...:|..|:.:|..|..|:.|:                            
  Fly   282 PDEVAKHEAAAHRLRLTYRCSECQREFELLAGLKKHLKTHRTEGRKDTWKKCPDCGKCLKLGSMW 346

  Fly   162 ---KIHTDERPYKCKHCDKAFRQISTLTNHVKIHTGEKPFTCNICAKDFRQQSTLINHIKTHKAA 223
               |||:|.:.|:|..|.:.|.|...||:|.:||:.|||:.|..|.|.|:::|.|          
  Fly   347 MHRKIHSDNKKYQCDICGQKFVQKINLTHHARIHSSEKPYECPECQKRFQERSHL---------- 401

  Fly   224 ESSTPTSLLNYQPQTGSGKHRKSQMHQAYQQQHQRVQISKTLYSGSYSSPAAEELVKPFQCSVCK 288
                                   |.||.|..|                       .:.::|..|.
  Fly   402 -----------------------QRHQKYHAQ-----------------------TRSYRCEKCG 420

  Fly   289 RRFPQLSTLHNHERTHIDPKPYKCETCDKSFSQLATLANHKKIHTGDKPYTCSYCHMQFRQQSTL 353
            :.:.....|..|...|::.:|:.|..|||||...:.|..|..||||.:|:.|:||...|......
  Fly   421 KMYKTERCLKVHNLVHLEQRPFACTVCDKSFISNSKLKQHSNIHTGMRPFKCNYCPRDFTNFPNW 485

  Fly   354 TNHL--------KTHTH-----------------QIAPGGVGGAGGGGGAV-------------- 379
            ..|.        ||..|                 |.|......|.....||              
  Fly   486 LKHTRRRHKVDHKTGEHLENIPSYCSKKSTTNKAQKAAAAAAAAAAASSAVNPNELSASSELKAK 550

  Fly   380 ---TATVDHSMPAPLAPG-----TQQLTSGLLPNNLHGSTANIIQLDHHPLL--HFLDGSTTVSS 434
               |:|   :.|||....     .||.|...|...|...|| :.|:...||.  |..:.:|.:..
  Fly   551 ANLTST---AAPAPAKQARKKKQPQQATLAALGITLPAGTA-LQQVHPVPLAQQHQQELTTVLVP 611

  Fly   435 VVATAAANTKVE 446
            :...|...||.:
  Fly   612 LAPPAPKQTKAK 623

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4360NP_650879.1 C2H2 Zn finger 144..164 CDD:275368 8/51 (16%)
zf-H2C2_2 157..181 CDD:290200 10/55 (18%)
C2H2 Zn finger 172..192 CDD:275368 8/20 (40%)
zf-H2C2_2 185..209 CDD:290200 12/24 (50%)
C2H2 Zn finger 200..220 CDD:275368 6/20 (30%)
C2H2 Zn finger 284..304 CDD:275368 4/20 (20%)
zf-C2H2_8 287..363 CDD:292531 26/101 (26%)
C2H2 Zn finger 312..332 CDD:275368 9/20 (45%)
C2H2 Zn finger 340..360 CDD:275368 7/28 (25%)
C2H2 Zn finger 478..498 CDD:275368
zf-H2C2_2 491..515 CDD:290200
C2H2 Zn finger 506..526 CDD:275368
zf-H2C2_2 519..543 CDD:290200
C2H2 Zn finger 534..554 CDD:275368
wdnNP_476900.1 C2H2 Zn finger 301..321 CDD:275368 6/20 (30%)
RPB9 333..425 CDD:224510 30/148 (20%)
C2H2 Zn finger 333..352 CDD:275368 2/19 (11%)
zf-H2C2_2 344..369 CDD:290200 8/25 (32%)
zf-C2H2 358..380 CDD:278523 9/22 (41%)
C2H2 Zn finger 360..380 CDD:275368 8/20 (40%)
zf-H2C2_2 372..395 CDD:290200 11/23 (48%)
zf-C2H2 386..408 CDD:278523 10/55 (18%)
C2H2 Zn finger 388..436 CDD:275368 15/104 (14%)
zf-H2C2_2 400..425 CDD:290200 8/81 (10%)
C2H2 Zn finger 416..433 CDD:275368 4/17 (24%)
zf-H2C2_2 429..453 CDD:290200 10/24 (42%)
C2H2 Zn finger 444..464 CDD:275368 9/20 (45%)
zf-H2C2_2 457..481 CDD:290200 11/24 (46%)
C2H2 Zn finger 472..493 CDD:275368 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24377
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.