DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4360 and cg

Sequence 1:NP_650879.1 Gene:CG4360 FlyBaseID:FBgn0038787 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001097306.2 Gene:cg FlyBaseID:FBgn0000289 Length:837 Species:Drosophila melanogaster

Alignment Length:589 Identity:136/590 (23%)
Similarity:182/590 (31%) Gaps:243/590 (41%)


  Fly     6 ATAATAAMANYQHYQLPASHGGGGGGGGGGGGGGGSNGGSGPGPNSGQQQPTTLASLQQSPF--- 67
            ||||.||.|              .||..|.........||.....:||...|..::..:|.|   
  Fly   121 ATAAAAAAA--------------AGGDSGLAHHHTLTNGSIVDAKTGQTVLTAGSAAAKSHFSSI 171

  Fly    68 -ALHQLT-----------AVQAIQHPTHQAMLHPQHPLVHLLDISTTTANSG-----GGG----- 110
             ||| ||           |:.|..|.||                 |.||..|     .||     
  Fly   172 GALH-LTQEECNEILIKRAIAAGHHQTH-----------------TITAADGSHHHASGGTPSFC 218

  Fly   111 --GGSHT---PISP-MKQEVQSVI----SEEEVVVDDPRKKKQCHVCKNKFRQLTTLRNHMKI-H 164
              ||:.|   .|.| :..:||.||    ..|:...:.|..|.:....  :....|.|:..|.. .
  Fly   219 SVGGATTLLGDILPGISVQVQKVIQGLEDNEDSQGEAPNLKLEPGTL--ELSPKTELQESMHFSE 281

  Fly   165 TD-----ERPYKCKHCDKAFRQISTLTNHVKIHTGEKPFTCNICAKDFRQQSTLINHIKTHKAAE 224
            ||     ||||.|..|.|:|.....||.|.::||||:|..|..|.|.|..:..|..|:..|... 
  Fly   282 TDATIKKERPYSCDECGKSFLLKHHLTTHARVHTGERPHICTHCGKSFAHKHCLNTHLLLHSTE- 345

  Fly   225 SSTPTSLLNYQPQTGSGKHRKSQMHQAYQQQHQRVQISKTLYSGSYSSPAAEELVKPFQCSVCKR 289
                                                                   :|:||..||:
  Fly   346 -------------------------------------------------------RPYQCQECKK 355

  Fly   290 RFPQLSTLHNHERTHIDPKPYKCETCDKSFSQLATLANHKKIHTGDKPYTCSYCHMQFRQQSTLT 354
            .|.....|..|.|.|...:|:.|:.|.::|.....|..|.|.|.|::||.|..|...|.|:    
  Fly   356 SFTLKHHLLTHSRVHSRERPFVCQECGRAFPLKRHLVTHSKFHAGERPYVCEECGESFAQE---- 416

  Fly   355 NHLKTHTHQIAPGGVGGAGGGGGAVTATVDHSMPAPLAPGTQQLTSGLLPNNLHGSTANIIQLDH 419
            |||..|                                            :..|||.        
  Fly   417 NHLIMH--------------------------------------------SRFHGSL-------- 429

  Fly   420 HPLLHFLDGSTTVSSVVATAAANTKVEHFQAGGSPSGRMTVVGTINMLKGDNPDRPFGCSVCQRF 484
                                                                  .||.|:.|...
  Fly   430 ------------------------------------------------------NPFVCAECGAS 440

  Fly   485 FSQQSTLVNHIKTHTGEKPYKCKICEVNFRQVATLNNHM-KIHTGEKPYNCSFCPKQFRQKSTLQ 548
            |.::..||||.:.| |:.|:.|.:|...|.|..||.:|| ::||||:.:.|..|.:.|..|:.|.
  Fly   441 FPRKFQLVNHGRIH-GKIPHSCTVCGKEFLQKRTLVSHMRRVHTGEQAHPCVSCGEGFLTKAELH 504

  Fly   549 NHLR 552
            .|:|
  Fly   505 QHVR 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4360NP_650879.1 C2H2 Zn finger 144..164 CDD:275368 3/21 (14%)
zf-H2C2_2 157..181 CDD:290200 12/30 (40%)
C2H2 Zn finger 172..192 CDD:275368 7/20 (35%)
zf-H2C2_2 185..209 CDD:290200 12/24 (50%)
C2H2 Zn finger 200..220 CDD:275368 6/20 (30%)
C2H2 Zn finger 284..304 CDD:275368 7/20 (35%)
zf-C2H2_8 287..363 CDD:292531 26/76 (34%)
C2H2 Zn finger 312..332 CDD:275368 6/20 (30%)
C2H2 Zn finger 340..360 CDD:275368 7/20 (35%)
C2H2 Zn finger 478..498 CDD:275368 7/20 (35%)
zf-H2C2_2 491..515 CDD:290200 10/24 (42%)
C2H2 Zn finger 506..526 CDD:275368 8/21 (38%)
zf-H2C2_2 519..543 CDD:290200 10/25 (40%)
C2H2 Zn finger 534..554 CDD:275368 7/20 (35%)
cgNP_001097306.2 COG5048 287..>371 CDD:227381 33/140 (24%)
C2H2 Zn finger 294..314 CDD:275368 7/20 (35%)
zf-H2C2_2 306..331 CDD:290200 12/25 (48%)
C2H2 Zn finger 322..342 CDD:275368 6/20 (30%)
C2H2 Zn finger 350..370 CDD:275368 7/20 (35%)
zf-H2C2_2 362..385 CDD:290200 7/23 (30%)
C2H2 Zn finger 378..398 CDD:275368 6/20 (30%)
zf-H2C2_2 390..415 CDD:290200 10/25 (40%)
C2H2 Zn finger 406..426 CDD:275368 8/68 (12%)
SIR2 <425..>465 CDD:294129 17/103 (17%)
C2H2 Zn finger 434..454 CDD:275368 7/20 (35%)
C2H2 Zn finger 461..482 CDD:275368 8/21 (38%)
C2H2 Zn finger 490..509 CDD:275368 7/20 (35%)
lambda-1 491..>603 CDD:212564 6/19 (32%)
C2H2 Zn finger 575..595 CDD:275368
C2H2 Zn finger 720..740 CDD:275368
C2H2 Zn finger 752..771 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C277494056
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.