DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4360 and ZNF48

Sequence 1:NP_650879.1 Gene:CG4360 FlyBaseID:FBgn0038787 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001201835.1 Gene:ZNF48 HGNCID:13114 Length:618 Species:Homo sapiens

Alignment Length:512 Identity:133/513 (26%)
Similarity:187/513 (36%) Gaps:159/513 (31%)


  Fly   144 CHVCKNKFRQLTTLRNHMKIHTDERPYKC--------------KH-------------------- 174
            |..|...|||::.|..|.:.||.|:||||              ||                    
Human   114 CGECGKSFRQMSDLVKHQRTHTGEKPYKCGVCGKGFGDSSARIKHQRTHSGEKPYRARPPAQGPP 178

  Fly   175 ------------------CDKAFRQISTLTNHVKIHTGEKPFTCNICAKDFRQQSTLINHIKTHK 221
                              |.|:|||.|.|..|.:.||||||:.|.||.|.|...|..|.|.:||:
Human   179 KIPRSRIPAGERPTICGECGKSFRQSSDLVKHQRTHTGEKPYKCGICGKGFGDSSARIKHQRTHR 243

  Fly   222 AAESSTPTSLLNYQPQTGSGKHRKSQMHQAYQQQHQRVQISKTLYSGSYSSPAAEELVKPFQCSV 286
            ..:...|.                     ..::|..|...:.|      ..|.|::  ||:.|:.
Human   244 GEQPPRPV---------------------VPRRQPSRAATAAT------QGPKAQD--KPYICTD 279

  Fly   287 CKRRFPQLSTLHNHERTHIDPKPYKCETCDKSFSQLATLANHKKIHTGDKPYTCSYCHMQFRQQS 351
            |.:||....:|.:|:|:|:.|||:.|:.|.|.|::.:.|..|.::|||:|||.|..|...|...|
Human   280 CGKRFVLSCSLLSHQRSHLGPKPFGCDVCGKEFARGSDLVKHLRVHTGEKPYLCPECGKGFADSS 344

  Fly   352 TLTNHLKTHTHQIAPGGVGGAGGGGGAVTATVDHSMPAPLAPGTQQLTSGLLPNNLHGSTANIIQ 416
            ....||:||:.: .|                  |:.|.  ...|..|:|.||.:.|.........
Human   345 ARVKHLRTHSGE-RP------------------HACPE--CDRTFSLSSTLLRHRLTHMEPQDFS 388

  Fly   417 LDHHPLLHFLDGSTT----VSSVVATAAANTKVEHFQAGG---SPSGRMTVVGTINMLKGDNP-- 472
            ...:||...:.....    .|..:...:.:...|.|...|   .|.|...         |:.|  
Human   389 FPGYPLPALIPSPPPPPLGTSPPLTPRSPSHSGEPFGLPGLEPEPGGPQA---------GEPPPP 444

  Fly   473 ---DRPFGCSVCQRFFSQQSTLVNHIKTHTGEKPYKCKICEVNFRQVATLNNHMKIHTGEK---- 530
               |:|..|..|.:.|.:.|.||.|.:.|||||||.|..|...|...:....|::.|.||:    
Human   445 LAGDKPHKCPECGKGFRRSSDLVKHHRVHTGEKPYLCPECGKGFADSSARVKHLRTHRGERARPP 509

  Fly   531 --------------------------------PYNCSFCPKQFRQKSTLQNHLRVHT 555
                                            |:.|.||.|:|.:.|.|..|.|.||
Human   510 PPSTLLRPHNPPGPVPMAPRPRVRAQPSGPSQPHVCGFCGKEFPRSSDLVKHRRTHT 566

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4360NP_650879.1 C2H2 Zn finger 144..164 CDD:275368 7/20 (35%)
zf-H2C2_2 157..181 CDD:290200 15/76 (20%)
C2H2 Zn finger 172..192 CDD:275368 11/72 (15%)
zf-H2C2_2 185..209 CDD:290200 13/24 (54%)
C2H2 Zn finger 200..220 CDD:275368 9/20 (45%)
C2H2 Zn finger 284..304 CDD:275368 7/20 (35%)
zf-C2H2_8 287..363 CDD:292531 30/76 (39%)
C2H2 Zn finger 312..332 CDD:275368 6/20 (30%)
C2H2 Zn finger 340..360 CDD:275368 7/20 (35%)
C2H2 Zn finger 478..498 CDD:275368 7/20 (35%)
zf-H2C2_2 491..515 CDD:290200 13/24 (54%)
C2H2 Zn finger 506..526 CDD:275368 4/20 (20%)
zf-H2C2_2 519..543 CDD:290200 10/60 (17%)
C2H2 Zn finger 534..554 CDD:275368 9/20 (45%)
ZNF48NP_001201835.1 zf-C2H2 113..134 CDD:278523 7/20 (35%)
COG5048 114..499 CDD:227381 118/444 (27%)
C2H2 Zn finger 114..134 CDD:275368 7/20 (35%)
zf-H2C2_2 126..149 CDD:290200 9/23 (39%)
C2H2 Zn finger 142..162 CDD:275368 3/20 (15%)
C2H2 Zn finger 194..214 CDD:275368 8/20 (40%)
zf-C2H2 194..214 CDD:278523 8/20 (40%)
zf-H2C2_2 206..229 CDD:290200 12/23 (52%)
C2H2 Zn finger 222..242 CDD:275368 9/20 (45%)
C2H2 Zn finger 277..297 CDD:275368 7/20 (35%)
C2H2 Zn finger 305..325 CDD:275368 6/20 (30%)
zf-H2C2_2 317..341 CDD:290200 11/24 (46%)
C2H2 Zn finger 333..353 CDD:275368 7/20 (35%)
zf-H2C2_2 348..369 CDD:290200 8/42 (19%)
C2H2 Zn finger 361..381 CDD:275368 7/22 (32%)
zf-C2H2 451..473 CDD:278523 7/22 (32%)
C2H2 Zn finger 453..473 CDD:275368 7/20 (35%)
zf-H2C2_2 465..489 CDD:290200 13/24 (54%)
C2H2 Zn finger 481..501 CDD:275368 4/20 (20%)
COG5048 524..>591 CDD:227381 12/44 (27%)
zf-C2H2 543..565 CDD:278523 9/22 (41%)
C2H2 Zn finger 545..565 CDD:275368 9/20 (45%)
zf-H2C2_2 557..580 CDD:290200 5/11 (45%)
C2H2 Zn finger 573..593 CDD:275370
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3714
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.