DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4360 and Zfp184

Sequence 1:NP_650879.1 Gene:CG4360 FlyBaseID:FBgn0038787 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_898835.1 Gene:Zfp184 MGIID:1922244 Length:737 Species:Mus musculus

Alignment Length:481 Identity:146/482 (30%)
Similarity:207/482 (43%) Gaps:96/482 (20%)


  Fly   113 SHTPISPMK-QEVQSVISEEEVVVDDPR-----KKKQCHVCKNKFRQLTTLRNHMKIHTDERPYK 171
            :||...|.| .|.....|..|.:::..|     |..:|..|...|.:..:|..|.:|||.|:|||
Mouse   222 THTGEKPYKCNECNKAFSRSENLINHQRIHTGDKPYKCDQCGKGFIEGPSLTQHQRIHTGEKPYK 286

  Fly   172 CKHCDKAFRQISTLTNHVKIHTGEKPFTCNICAKDFRQQSTLINHIKTHKAAESSTPTSLLNYQP 236
            |..|.|||.|.:.|..|.:|||||||:||..|.|.|.|:...:.|.|.|                
Mouse   287 CDECGKAFSQRTHLVQHQRIHTGEKPYTCTECGKSFSQRGHFMEHQKIH---------------- 335

  Fly   237 QTGSGKHRKSQMHQAYQQ-----QHQRVQISKTLY-----SGSYSSPAA---EELV----KPFQC 284
             ||....:..:..:.:.:     |||::...:..|     ..:::.|:.   ..::    ||::|
Mouse   336 -TGEKPFKCEECEKTFTRSTHLTQHQKIHTGEKTYKCNECGKAFNGPSTFIRHHMIHTGEKPYEC 399

  Fly   285 SVCKRRFPQLSTLHNHERTHIDPKPYKCETCDKSFSQLATLANHKKIHTGDKPYTCSYCHMQFRQ 349
            :.|.:.|.|.|.|..|::||...|||.|..|.|:||..::||.|.|||||:|||.||.|...|..
Mouse   400 NECGKAFSQHSNLTQHQKTHTGEKPYDCAECGKAFSYWSSLAQHLKIHTGEKPYKCSDCGKAFSY 464

  Fly   350 QSTLTNHLKTHTHQIAPGGVGGAGGGGGAVTATVDHSMPAPLAPGTQQLTSGLLPNNLHGSTANI 414
            .|:||.|.:.||.: .|......|                                   .:.:.:
Mouse   465 CSSLTQHRRIHTRE-KPFECSECG-----------------------------------KAFSYL 493

  Fly   415 IQLDHHPLLHFLD--------GSTTVSSVVATAAANTKVEHFQAGGSP-----SGRMTVVGT--I 464
            ..|:.|...|..:        |...:.|     ::..|.|....|..|     .|:....|:  |
Mouse   494 SNLNQHQKTHTQEKAYECKECGKAFIRS-----SSLAKHERIHTGEKPYQCHECGKTFSYGSSLI 553

  Fly   465 NMLKGDNPDRPFGCSVCQRFFSQQSTLVNHIKTHTGEKPYKCKICEVNFRQVATLNNHMKIHTGE 529
            ...|....:||:.|:.|.|.|:|:..|..|.:.|||.|||.|..|...||..::|..|.|.||.|
Mouse   554 QHKKIHTGERPYKCNECGRAFNQKIHLTQHKRIHTGAKPYACPKCGKTFRHCSSLAQHQKTHTEE 618

  Fly   530 KPYNCSFCPKQFRQKSTLQNHLRVHT 555
            |||.|:.|.|.|.|.|.|..|.|:||
Mouse   619 KPYQCNKCEKTFSQNSRLTQHQRIHT 644

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4360NP_650879.1 C2H2 Zn finger 144..164 CDD:275368 6/20 (30%)
zf-H2C2_2 157..181 CDD:290200 14/24 (58%)
C2H2 Zn finger 172..192 CDD:275368 9/20 (45%)
zf-H2C2_2 185..209 CDD:290200 14/24 (58%)
C2H2 Zn finger 200..220 CDD:275368 7/20 (35%)
C2H2 Zn finger 284..304 CDD:275368 8/20 (40%)
zf-C2H2_8 287..363 CDD:292531 37/76 (49%)
C2H2 Zn finger 312..332 CDD:275368 10/20 (50%)
C2H2 Zn finger 340..360 CDD:275368 8/20 (40%)
C2H2 Zn finger 478..498 CDD:275368 7/20 (35%)
zf-H2C2_2 491..515 CDD:290200 12/24 (50%)
C2H2 Zn finger 506..526 CDD:275368 7/20 (35%)
zf-H2C2_2 519..543 CDD:290200 13/24 (54%)
C2H2 Zn finger 534..554 CDD:275368 9/20 (45%)
Zfp184NP_898835.1 KRAB 28..88 CDD:214630
KRAB 28..67 CDD:279668
COG5048 163..634 CDD:227381 140/470 (30%)
C2H2 Zn finger 203..223 CDD:275368 0/1 (0%)
zf-H2C2_2 215..240 CDD:290200 6/18 (33%)
C2H2 Zn finger 231..251 CDD:275368 4/20 (20%)
zf-H2C2_2 243..266 CDD:290200 4/23 (17%)
C2H2 Zn finger 259..279 CDD:275368 6/20 (30%)
zf-H2C2_2 271..296 CDD:290200 14/25 (56%)
C2H2 Zn finger 287..307 CDD:275368 9/20 (45%)
zf-H2C2_2 299..324 CDD:290200 14/25 (56%)
C2H2 Zn finger 315..335 CDD:275368 7/20 (35%)
zf-H2C2_2 327..352 CDD:290200 5/42 (12%)
C2H2 Zn finger 343..363 CDD:275368 3/20 (15%)
zf-H2C2_2 355..379 CDD:290200 4/24 (17%)
C2H2 Zn finger 371..391 CDD:275368 1/20 (5%)
zf-H2C2_2 386..408 CDD:290200 5/22 (23%)
C2H2 Zn finger 399..419 CDD:275368 8/20 (40%)
zf-H2C2_2 411..436 CDD:290200 12/25 (48%)
C2H2 Zn finger 427..447 CDD:275368 10/20 (50%)
zf-H2C2_2 439..464 CDD:290200 15/25 (60%)
C2H2 Zn finger 455..475 CDD:275368 8/20 (40%)
zf-H2C2_2 467..492 CDD:290200 7/61 (11%)
C2H2 Zn finger 483..503 CDD:275368 3/55 (5%)
zf-H2C2_2 495..520 CDD:290200 4/25 (16%)
C2H2 Zn finger 511..531 CDD:275368 4/25 (16%)
zf-H2C2_2 523..548 CDD:290200 5/25 (20%)
C2H2 Zn finger 539..559 CDD:275368 4/20 (20%)
zf-H2C2_2 551..576 CDD:290200 8/25 (32%)
C2H2 Zn finger 567..587 CDD:275368 7/20 (35%)
zf-H2C2_2 579..604 CDD:290200 12/25 (48%)
C2H2 Zn finger 595..615 CDD:275368 7/20 (35%)
zf-H2C2_2 607..632 CDD:290200 13/25 (52%)
C2H2 Zn finger 623..643 CDD:275368 9/20 (45%)
zf-H2C2_2 636..659 CDD:290200 5/10 (50%)
C2H2 Zn finger 651..671 CDD:275368
C2H2 Zn finger 679..698 CDD:275368
C2H2 Zn finger 706..726 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.