DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4360 and si:dkey-182i3.9

Sequence 1:NP_650879.1 Gene:CG4360 FlyBaseID:FBgn0038787 Length:556 Species:Drosophila melanogaster
Sequence 2:XP_009290015.1 Gene:si:dkey-182i3.9 ZFINID:ZDB-GENE-121214-310 Length:670 Species:Danio rerio

Alignment Length:436 Identity:126/437 (29%)
Similarity:183/437 (42%) Gaps:89/437 (20%)


  Fly   140 KKKQCHVCKNKFRQLTTLRNHMKIHTDERPYKCKHCDKAFRQISTLTNHVKIHTGEKPFTCNICA 204
            ||..|..|...|   ..|:.|.::|.:.:|:.|..|.:.|....||..|.:|||||||::|..|.
Zfish   276 KKGTCKTCGKSF---ADLKMHERVHLEVKPFLCSICGRGFTVKGTLMEHQRIHTGEKPYSCETCG 337

  Fly   205 KDFRQQSTLINHIKTHKAAESSTPTSLLNYQPQTGSGKHRKSQMHQAYQQQHQRVQISKTLYSGS 269
            |.|.|...|.||:..|| .|.....||.:   :|...|| ..::||             .:::|.
Zfish   338 KQFAQTQNLTNHLLVHK-TEKPWKCSLCD---KTFKSKH-NMKLHQ-------------IVHTGE 384

  Fly   270 YSSPAAEELVKPFQCSVCKRRFPQLSTLHNHERTHIDPKPYKCETCDKSFSQLATLANHKKIHTG 334
                      |...|.:|.::|...:.|..|...|...|.|.||.|.|.|.|...|..|..||..
Zfish   385 ----------KSHICHICGQKFGHGTNLKRHLLLHSGVKRYGCEICSKRFYQSIALKRHMAIHGA 439

  Fly   335 DKPYTCSYCHMQFRQQSTLTNHLKTHTHQIAPGGVGGAGGGGGAVTATVDHSMPAPLAPGTQQLT 399
            .||:.|..|...|.....|..||.||.::     ..|..|.|        .:.|..:...:.. |
Zfish   440 PKPFMCDICGKSFVFNFALQKHLLTHRNK-----TNGKSGTG--------KTFPCDMCEKSYS-T 490

  Fly   400 SGLLP--NNLHG------------STANIIQLDHHPLLHFLDGSTTVSSVVATAAANT------K 444
            :.||.  ..||.            |..::..|..|..|| |..|.....|.:.:..|.      :
Zfish   491 NALLKMHQRLHSEKDPYMCKVCGKSYVSVYSLRIHERLH-LGVSMWKCDVCSKSFCNKYGLKLHQ 554

  Fly   445 VEHFQAGGSPSGRMTVVGTINMLKGDNPDRPFGCSVCQRFFSQQSTLVNHIKTHTGEKPYKCKIC 509
            |.|                       ..::|:.||||.:.:.|..:|..||:.|:||||:|||.|
Zfish   555 VVH-----------------------TKEKPYECSVCGKTYGQPHSLKTHIRIHSGEKPHKCKTC 596

  Fly   510 EVNFRQVATLNNHMKIHTGEKPYNCSFCPKQFRQKSTLQNHLRVHT 555
            .::||....|:.|.:|||||:|::|..|.|:|.|.:.::.|:::||
Zfish   597 GMSFRLPGNLSRHKRIHTGERPFSCEVCGKRFVQHNHVKAHMQIHT 642

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4360NP_650879.1 C2H2 Zn finger 144..164 CDD:275368 5/20 (25%)
zf-H2C2_2 157..181 CDD:290200 7/24 (29%)
C2H2 Zn finger 172..192 CDD:275368 7/20 (35%)
zf-H2C2_2 185..209 CDD:290200 13/24 (54%)
C2H2 Zn finger 200..220 CDD:275368 8/20 (40%)
C2H2 Zn finger 284..304 CDD:275368 5/20 (25%)
zf-C2H2_8 287..363 CDD:292531 27/76 (36%)
C2H2 Zn finger 312..332 CDD:275368 9/20 (45%)
C2H2 Zn finger 340..360 CDD:275368 7/20 (35%)
C2H2 Zn finger 478..498 CDD:275368 8/20 (40%)
zf-H2C2_2 491..515 CDD:290200 14/24 (58%)
C2H2 Zn finger 506..526 CDD:275368 8/20 (40%)
zf-H2C2_2 519..543 CDD:290200 12/24 (50%)
C2H2 Zn finger 534..554 CDD:275368 6/20 (30%)
si:dkey-182i3.9XP_009290015.1 C2H2 Zn finger 280..297 CDD:275368 5/20 (25%)
COG5048 301..665 CDD:227381 118/409 (29%)
C2H2 Zn finger 305..325 CDD:275368 7/20 (35%)
zf-H2C2_2 318..342 CDD:290200 13/24 (54%)
C2H2 Zn finger 333..353 CDD:275368 8/20 (40%)
C2H2 Zn finger 361..381 CDD:275368 7/37 (19%)
C2H2 Zn finger 389..409 CDD:275368 5/20 (25%)
C2H2 Zn finger 417..437 CDD:275368 9/20 (45%)
zf-H2C2_2 429..453 CDD:290200 9/24 (38%)
C2H2 Zn finger 445..465 CDD:275368 7/20 (35%)
C2H2 Zn finger 481..501 CDD:275368 4/21 (19%)
C2H2 Zn finger 509..529 CDD:275368 4/20 (20%)
C2H2 Zn finger 537..557 CDD:275368 3/20 (15%)
C2H2 Zn finger 565..585 CDD:275368 8/20 (40%)
zf-H2C2_2 577..600 CDD:290200 12/23 (52%)
C2H2 Zn finger 593..613 CDD:275368 8/20 (40%)
zf-H2C2_2 605..630 CDD:290200 12/25 (48%)
C2H2 Zn finger 621..641 CDD:275368 6/20 (30%)
C2H2 Zn finger 649..665 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.