DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4360 and LOC101883356

Sequence 1:NP_650879.1 Gene:CG4360 FlyBaseID:FBgn0038787 Length:556 Species:Drosophila melanogaster
Sequence 2:XP_009290247.2 Gene:LOC101883356 ID: Length:777 Species:Danio rerio

Alignment Length:516 Identity:143/517 (28%)
Similarity:211/517 (41%) Gaps:157/517 (30%)


  Fly   111 GGSHTPISPMKQEVQSVISEEEVVVDDPRKKKQCHVCKNKFRQLTTLRNHMKIHTDERPYKCKHC 175
            |.|.:.:...||..::         .:.::..:|..|...|....:|:.|.:|||.|:|:||.:|
Zfish    61 GKSFSQLDSYKQHQKT---------HEDKRDHECLQCGKSFTTAGSLKIHQRIHTGEKPHKCSYC 116

  Fly   176 DKAFRQISTLTNHVKIHTGEKPFTCNICAKDFRQQSTLINHIKTHKAAESSTPTSLLNYQPQTGS 240
            :|:|.....|.:|.:|||||||:.|..|.|.|:.:|:|..|:..|...:..|.|       |.|.
Zfish   117 EKSFSHSGHLKSHERIHTGEKPYHCTQCGKSFKDKSSLTYHLLVHTGEKPFTCT-------QCGH 174

  Fly   241 GKHRKSQMHQAYQQQHQRVQISKTLYSGSYSSPAAEELVKPFQCSVCKRRFPQLSTLHNHERTHI 305
            .....|.:     :||.|:..::                ||:.|..|::||.:|.....|::||.
Zfish   175 DFRSSSNL-----KQHMRIHTNE----------------KPYACLFCEKRFSRLCDCKRHQKTHT 218

  Fly   306 DPKPYKCETCDKSFSQLATLANHKKIHTGDKPYTCSYCHMQFRQQSTLTNHLKTHTHQIAPGGVG 370
            ..:.::|..|.|||:|..:|..|:.||||:||:.||||...|.:.|.|.:|.:.||.:       
Zfish   219 GERDHECLQCGKSFTQSGSLKIHQMIHTGEKPHKCSYCEKSFSRSSHLKSHERIHTGE------- 276

  Fly   371 GAGGGGGAVTATVDHSMPAP-LAPGTQQLTSGLLPNNLHGSTANIIQLDHHPLLHFLDGSTTVSS 434
                              .| ..|..|:            |..:...|.:|.|:|  .|....||
Zfish   277 ------------------KPYCCPPCQK------------SFKDSCSLTYHLLVH--TGEKPFSS 309

  Fly   435 --VVATAAAN-----------------------------TKVEHF----QAGGS-------PSGR 457
              ::.|..|:                             ||..|.    |.|.|       ...|
Zfish   310 YPIIKTRRASKLSGDHSDQMEENEQRQEEDEERNFNTKGTKTTHLHSCRQCGKSFRRKSKLKKHR 374

  Fly   458 MTVVGTINMLKGDNPDRPFGCSVCQRFFSQQSTLVNHIKT------------------------- 497
            .|..|          ::|:.|:.|.:.|||..:...|.||                         
Zfish   375 KTHAG----------EKPYTCTECGKSFSQLDSYKQHQKTHEDKRDHECLQCGKSFTTAGHLKIH 429

  Fly   498 ---HTGEKPYKCKICEVNFRQVATLNNHMKIHTGEKPYNCSFCPKQFRQKSTLQNHLRVHT 555
               |||||||||..||.:|.|.:.|..|.:||||||||:|:.|.|.::.||:|..||.|||
Zfish   430 QRIHTGEKPYKCSYCEKSFSQSSDLKKHERIHTGEKPYHCTQCGKSYKDKSSLTYHLLVHT 490

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4360NP_650879.1 C2H2 Zn finger 144..164 CDD:275368 6/20 (30%)
zf-H2C2_2 157..181 CDD:290200 12/24 (50%)
C2H2 Zn finger 172..192 CDD:275368 7/20 (35%)
zf-H2C2_2 185..209 CDD:290200 13/24 (54%)
C2H2 Zn finger 200..220 CDD:275368 7/20 (35%)
C2H2 Zn finger 284..304 CDD:275368 7/20 (35%)
zf-C2H2_8 287..363 CDD:292531 31/76 (41%)
C2H2 Zn finger 312..332 CDD:275368 9/20 (45%)
C2H2 Zn finger 340..360 CDD:275368 8/20 (40%)
C2H2 Zn finger 478..498 CDD:275368 8/48 (17%)
zf-H2C2_2 491..515 CDD:290200 15/52 (29%)
C2H2 Zn finger 506..526 CDD:275368 8/20 (40%)
zf-H2C2_2 519..543 CDD:290200 13/24 (54%)
C2H2 Zn finger 534..554 CDD:275368 9/20 (45%)
LOC101883356XP_009290247.2 COG5048 26..420 CDD:227381 109/445 (24%)
C2H2 Zn finger 29..49 CDD:275368
C2H2 Zn finger 57..77 CDD:275368 4/25 (16%)
C2H2 Zn finger 85..105 CDD:275368 6/20 (30%)
C2H2 Zn finger 113..133 CDD:275368 7/20 (35%)
C2H2 Zn finger 141..161 CDD:275368 7/20 (35%)
C2H2 Zn finger 169..189 CDD:275368 7/32 (22%)
C2H2 Zn finger 197..217 CDD:275368 7/20 (35%)
C2H2 Zn finger 225..245 CDD:275368 9/20 (45%)
C2H2 Zn finger 253..273 CDD:275368 8/20 (40%)
C2H2 Zn finger 281..301 CDD:275368 6/32 (19%)
COG5048 354..737 CDD:227381 49/148 (33%)
C2H2 Zn finger 357..377 CDD:275368 5/20 (25%)
C2H2 Zn finger 385..405 CDD:275368 8/20 (40%)
C2H2 Zn finger 413..433 CDD:275368 0/20 (0%)
C2H2 Zn finger 441..461 CDD:275368 8/20 (40%)
C2H2 Zn finger 469..489 CDD:275368 9/20 (45%)
C2H2 Zn finger 497..517 CDD:275368
C2H2 Zn finger 525..545 CDD:275368
C2H2 Zn finger 553..573 CDD:275368
C2H2 Zn finger 581..601 CDD:275368
C2H2 Zn finger 609..629 CDD:275368
C2H2 Zn finger 637..657 CDD:275368
C2H2 Zn finger 665..685 CDD:275368
C2H2 Zn finger 693..713 CDD:275368
C2H2 Zn finger 721..741 CDD:275368
C2H2 Zn finger 749..769 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.