DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4360 and ZNF605

Sequence 1:NP_650879.1 Gene:CG4360 FlyBaseID:FBgn0038787 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001158187.1 Gene:ZNF605 HGNCID:28068 Length:672 Species:Homo sapiens

Alignment Length:425 Identity:132/426 (31%)
Similarity:189/426 (44%) Gaps:80/426 (19%)


  Fly   144 CHVCKNKFRQLTTLRNHMKIHTDERPYKCKHCDKAFRQISTLTNHVKIHTGEKPFTCNICAKDFR 208
            |..|...|.:.:.|..|.:.||.|:||:|..|.|||.|.|.||.|.:.|:||||..|:.|.|.|.
Human   202 CMECGRFFNKKSQLVIHQRTHTGEKPYQCSECGKAFSQKSLLTVHQRTHSGEKPHGCSECQKAFS 266

  Fly   209 QQSTLINHIKTHKAAESSTPTSLLNYQPQTGSGKHRKSQMHQAYQQQHQRVQISKTLYSGSYSSP 273
            ::|.||.|.:.|                 ||.                                 
Human   267 RKSLLILHQRIH-----------------TGE--------------------------------- 281

  Fly   274 AAEELVKPFQCSVCKRRFPQLSTLHNHERTHIDPKPYKCETCDKSFSQLATLANHKKIHTGDKPY 338
                  ||:.||.|.:.|.:.|.|..|:.||...|||.|..|.|:|||...|..|::.|||:|||
Human   282 ------KPYGCSECGKAFSRKSQLKRHQITHTIEKPYSCSECGKAFSQKLKLITHQRAHTGEKPY 340

  Fly   339 TCSYCHMQFRQQSTLTNHLKTHTHQIAPGGVGGAGGGGGAVTATVDHSMPAPLAPGTQQLTSGLL 403
            .||:|...|..:|.|..|.:|||.: .|.|.|.........:..:.|          |::.:|..
Human   341 PCSHCGKAFFWKSQLITHQRTHTGK-KPYGCGECQKAFSRNSLLIRH----------QRIHTGEK 394

  Fly   404 PNNLHGSTANII---QLDHHPLLHFLDGSTTVSSVVATAAANTKV---EHFQAGGSPSGRM---- 458
            |...:......|   ||..|.:.|..:.:...|.........:::   :....|..|.|.:    
Human   395 PYECNECGEAFIRKPQLIKHQITHTGEKNYRCSDCEEAFFKKSELIRHQKIHLGEKPYGCIQCGK 459

  Fly   459 TVVGTINML---KGDNPDRPFGCSVCQRFFSQQSTLVNHIKTHTGEKPYKCKICEVNFRQVATLN 520
            |..|...:|   :....::|:.||.|.:.|:|:|:|::|.:||||||||:|..|...|.:.::|.
Human   460 TFFGKSQLLTHHRTHTGEKPYECSECGKAFTQKSSLISHQRTHTGEKPYECSECRKTFSEKSSLI 524

  Fly   521 NHMKIHTGEKPYNCSFCPKQFRQKSTLQNHLRVHT 555
            :|.:.||||||:.||.|.|.|..|..|..|.|:||
Human   525 HHQRTHTGEKPFECSECRKAFAWKPQLLRHQRIHT 559

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4360NP_650879.1 C2H2 Zn finger 144..164 CDD:275368 5/20 (25%)
zf-H2C2_2 157..181 CDD:290200 12/24 (50%)
C2H2 Zn finger 172..192 CDD:275368 10/20 (50%)
zf-H2C2_2 185..209 CDD:290200 12/24 (50%)
C2H2 Zn finger 200..220 CDD:275368 8/20 (40%)
C2H2 Zn finger 284..304 CDD:275368 8/20 (40%)
zf-C2H2_8 287..363 CDD:292531 34/76 (45%)
C2H2 Zn finger 312..332 CDD:275368 8/20 (40%)
C2H2 Zn finger 340..360 CDD:275368 8/20 (40%)
C2H2 Zn finger 478..498 CDD:275368 9/20 (45%)
zf-H2C2_2 491..515 CDD:290200 13/24 (54%)
C2H2 Zn finger 506..526 CDD:275368 5/20 (25%)
zf-H2C2_2 519..543 CDD:290200 13/24 (54%)
C2H2 Zn finger 534..554 CDD:275368 9/20 (45%)
ZNF605NP_001158187.1 KRAB 7..65 CDD:214630
KRAB 7..45 CDD:279668
C2H2 Zn finger 176..196 CDD:275368
COG5048 199..603 CDD:227381 132/426 (31%)
C2H2 Zn finger 202..222 CDD:275368 5/20 (25%)
zf-H2C2_2 215..239 CDD:290200 12/24 (50%)
C2H2 Zn finger 230..250 CDD:275368 10/20 (50%)
C2H2 Zn finger 258..278 CDD:275368 8/20 (40%)
C2H2 Zn finger 286..306 CDD:275368 8/20 (40%)
zf-H2C2_2 299..323 CDD:290200 12/24 (50%)
C2H2 Zn finger 314..334 CDD:275368 8/20 (40%)
C2H2 Zn finger 342..362 CDD:275368 8/20 (40%)
C2H2 Zn finger 370..390 CDD:275368 3/30 (10%)
zf-H2C2_2 383..407 CDD:290200 5/34 (15%)
C2H2 Zn finger 398..418 CDD:275368 4/20 (20%)
C2H2 Zn finger 426..446 CDD:275368 1/20 (5%)
C2H2 Zn finger 454..474 CDD:275368 3/20 (15%)
zf-H2C2_2 467..491 CDD:290200 6/24 (25%)
C2H2 Zn finger 482..502 CDD:275368 9/20 (45%)
zf-H2C2_2 494..518 CDD:290200 13/24 (54%)
C2H2 Zn finger 510..530 CDD:275368 5/20 (25%)
zf-H2C2_2 522..546 CDD:290200 13/24 (54%)
C2H2 Zn finger 538..558 CDD:275368 9/20 (45%)
zf-H2C2_2 551..575 CDD:290200 5/10 (50%)
C2H2 Zn finger 566..586 CDD:275368
C2H2 Zn finger 594..614 CDD:275368
zf-H2C2_2 607..631 CDD:290200
zf-C2H2 620..642 CDD:278523
C2H2 Zn finger 622..642 CDD:275368
C2H2 Zn finger 650..670 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.