DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4367 and CG42598

Sequence 1:NP_001287421.2 Gene:CG4367 FlyBaseID:FBgn0038783 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001163857.2 Gene:CG42598 FlyBaseID:FBgn0260997 Length:340 Species:Drosophila melanogaster

Alignment Length:200 Identity:84/200 (42%)
Similarity:122/200 (61%) Gaps:15/200 (8%)


  Fly    23 GHGMMLSPTGRSSRWRYDNSAPTNYDDNALYCGGFWKQTE-NDGKCGLCGDDWSLEQPRPNELGG 86
            |||.::.|.||:|.||:....|.:|:|:.|.|||..:|.: |.||||.|||.|.|.:|||:|.||
  Fly    29 GHGRLVEPPGRASAWRFGFQTPPDYNDHELNCGGLSRQWQRNGGKCGECGDAWDLPEPRPHEYGG 93

  Fly    87 KYGSGVIVKSFAGVDEAEINVKITANHLGYFRFHICDLDENGSESEDCFNQYPLNFTDGS----- 146
            .:|.|.||:|:....:..|.|::||:|:|||.|.||   .|.:..:.|.::..|:..:||     
  Fly    94 HWGKGQIVRSYLPGSQMTIRVELTASHMGYFEFRIC---PNPNAKQSCLDENVLSILNGSPSQPN 155

  Fly   147 -----QKYYINTTTGDIPVTVKLPSDLNCIHCVLRWTYTAGNNWGVCEDGTGAMGCGAQETFINC 206
                 .::|....:....:..:|| |..|.||||:|.|.||||||:|.:|.||:|||.||.|.:|
  Fly   156 ESDLDTRFYPRNGSCIYEILAQLP-DFTCEHCVLQWRYVAGNNWGMCGNGIGAIGCGPQEEFRSC 219

  Fly   207 ADISV 211
            :||::
  Fly   220 SDIAL 224

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4367NP_001287421.2 None
CG42598NP_001163857.2 Chitin_bind_3 30..222 CDD:281112 82/196 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131060728
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21113
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.