DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4367 and CG4362

Sequence 1:NP_001287421.2 Gene:CG4367 FlyBaseID:FBgn0038783 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_650876.1 Gene:CG4362 FlyBaseID:FBgn0038784 Length:233 Species:Drosophila melanogaster

Alignment Length:230 Identity:121/231 (52%)
Similarity:158/231 (68%) Gaps:13/231 (6%)


  Fly    10 LSMGFLNRMG--ELEGHGMMLSPTGRSSRWRYDNSAPTNYDDNALYCGGFWKQTENDGKCGLCGD 72
            |||..|..:|  :::.|||||||..||||||||.|||.|::||.|:|||.:.|:.|.|:||||||
  Fly     5 LSMTLLLAIGLQQIDAHGMMLSPPSRSSRWRYDGSAPQNWNDNELFCGGLYTQSNNGGRCGLCGD 69

  Fly    73 DWSLEQPRPNELGGKY-GSGVIVKSFAGVDEAEINVKITANHLGYFRFHICDLDENGSESEDCFN 136
            ::...|||.||:||.. |:||:.:|:...:...:.||||.||||||.||:|:||..|:|||:||:
  Fly    70 NFLDAQPRANEIGGSIGGAGVVTRSYVAGNTITVGVKITTNHLGYFEFHLCNLDAFGAESEECFD 134

  Fly   137 QYPLNFTDGSQKYYINTTTGDIPVTVKLPSDLNCIHCVLRWTYTAGNNWGVCED-GTGAMGCGAQ 200
            |..|.|.|||.:..|....|:..|||.||..|.|.||||||||...||||:|:: |.||:|||.|
  Fly   135 QNRLRFIDGSDRKDIGDQMGEFDVTVVLPEGLTCSHCVLRWTYVGANNWGICDNSGNGALGCGPQ 199

  Fly   201 ETFINCADISVLSSARSIIQEV--------PVEVA 227
            |||.||||:|:. ..|::::|:        |||||
  Fly   200 ETFKNCADVSIY-WGRNLVKELVGGGDPVAPVEVA 233

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4367NP_001287421.2 None
CG4362NP_650876.1 Chitin_bind_3 21..208 CDD:281112 108/187 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131060549
eggNOG 1 0.900 E1_28MU0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21113
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.