DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4367 and CG42749

Sequence 1:NP_001287421.2 Gene:CG4367 FlyBaseID:FBgn0038783 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001188545.1 Gene:CG42749 FlyBaseID:FBgn0261803 Length:345 Species:Drosophila melanogaster

Alignment Length:214 Identity:82/215 (38%)
Similarity:128/215 (60%) Gaps:13/215 (6%)


  Fly    12 MGF---LNRMGELEGHGMMLSPTGRSSRWRYDNSAPTNYDDNALYCGGF---WKQTENDGKCGLC 70
            :||   :..|..:.|||.::.|..|::.||:....|.||:||.|:|||:   |:|  |.|:||:|
  Fly    20 LGFVVLMQLMASVRGHGRLMDPPARNAMWRFGYPNPVNYNDNELFCGGYAVQWEQ--NKGRCGIC 82

  Fly    71 GDDWSLEQPRPNELGGKYGSGVIVKSFAGVDEAEINVKITANHLGYFRFHICDLDENGSE-SEDC 134
            ||.:.::.|||:|.||:|..|:|.:.:......::.|::||||.|.|...:|..:....| ::.|
  Fly    83 GDAYHVKSPRPHEAGGQYAKGIISRYYTAGQTIDVEVELTANHYGRFEMFLCPNNNPRQEATQQC 147

  Fly   135 FNQYPLNFTDGSQKYYI---NTTTGDI-PVTVKLPSDLNCIHCVLRWTYTAGNNWGVCEDGTGAM 195
            |::|||..:...:..|:   :....|| ...|:||..:.|..|||:|||...|.||.|.:||.|:
  Fly   148 FDRYPLLISGSREHRYLIPRDAKKKDIFRYKVRLPPYVTCTQCVLQWTYYTANMWGTCANGTEAV 212

  Fly   196 GCGAQETFINCADISVLSS 214
            |||..|||.||||::::|:
  Fly   213 GCGKAETFRNCADVAIVSN 231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4367NP_001287421.2 None
CG42749NP_001188545.1 Chitin_bind_3 35..226 CDD:281112 77/193 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131060589
eggNOG 1 0.900 E1_28MU0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21113
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.